| Tbio | Protein phosphatase 1F |
Dephosphorylates and concomitantly deactivates CaM-kinase II activated upon autophosphorylation, and CaM-kinases IV and I activated upon phosphorylation by CaM-kinase kinase. Promotes apoptosis.
The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase can interact with Rho guanine nucleotide exchange factors (PIX), and thus block the effects of p21-activated kinase 1 (PAK), a protein kinase mediating biological effects downstream of Rho GTPases. Calcium/calmodulin-dependent protein kinase II gamma (CAMK2G/CAMK-II) is found to be one of the substrates of this phosphatase. The overexpression of this phosphatase or CAMK2G has been shown to mediate caspase-dependent apoptosis. An alternatively spliced transcript variant has been identified, but its full-length nature has not been determined. [provided by RefSeq, Jul 2008]
The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase can interact with Rho guanine nucleotide exchange factors (PIX), and thus block the effects of p21-activated kinase 1 (PAK), a protein kinase mediating biological effects downstream of Rho GTPases. Calcium/calmodulin-dependent protein kinase II gamma (CAMK2G/CAMK-II) is found to be one of the substrates of this phosphatase. The overexpression of this phosphatase or CAMK2G has been shown to mediate caspase-dependent apoptosis. An alternatively spliced transcript variant has been identified, but its full-length nature has not been determined. [provided by RefSeq, Jul 2008]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| lung adenocarcinoma | 2714 | 1.2e-19 |
| osteosarcoma | 7933 | 1.7e-08 |
| invasive ductal carcinoma | 2950 | 3.6e-03 |
| Disease | log2 FC | p |
|---|---|---|
| osteosarcoma | 1.606 | 1.7e-08 |
| lung adenocarcinoma | -1.334 | 1.2e-19 |
| invasive ductal carcinoma | -1.300 | 3.6e-03 |
| PMID | Text | |
|---|---|---|
| 26498692 | Overexpression of PPM1F is associated with metastasis of hepatocellular carcinoma. | |
| 24338362 | POPX2 affects trafficking by determining the phosphorylation status of KIF3A at serine 690. | |
| 23621870 | POPX2 might regulate cell motility through its regulation of the MAPK1/3, leading to changes in the cytoskeleton and cell motility. | |
| 22743349 | hCaMKP activity is reversibly regulated by oxidation/reduction at Cys-359 | |
| 22144583 | FHOD1 and PPM1F (direct regulators of the actin cytoskeleton) were identified as novel targets of miR-200c. Expression levels of FHOD1 and PPM1F were inversely correlated with miR-200c level in breast cancer cell lines and breast cancer patient samples. | |
| 21656682 | Data identify a biochemical pathway through which POPX2 exerts its apparent cellular function: the regulation of activity of glycogen synthase kinase-3, which in turn modulates extracellular signal-regulated kinase and cell motility. | |
| 20379614 | Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) | |
| 20016286 | The POPX2 phosphatase regulates cancer cell motility and invasiveness. | |
| 15140879 | PPM1F plays a key role in the regulation of CaMKII intracellularly | |
| 12539042 | Microarray analysis indicates HIV-1 Tat downregulates the expression of many proteins, including protein phosphatase 1F (KIAA0015), in immature dendritic cells, an effect that likely facilitates the expansion of HIV-1 infection | |
| 11864573 | The p21-activated kinase PAK is negatively regulated by POPX1 and POPX2, a pair of serine/threonine phosphatases of the PP2C family. (POPX1; POPX2) |
MSSGAPQKSSPMASGAEETPGFLDTLLQDFPALLNPEDPLPWKAPGTVLSQEEVEGELAELAMGFLGSRK 1 - 70 APPPLAAALAHEAVSQLLQTDLSEFRKLPREEEEEEEDDDEEEKAPVTLLDAQSLAQSFFNRLWEVAGQW 71 - 140 QKQVPLAARASQRQWLVSIHAIRNTRRKMEDRHVSLPSFNQLFGLSDPVNRAYFAVFDGHGGVDAARYAA 141 - 210 VHVHTNAARQPELPTDPEGALREAFRRTDQMFLRKAKRERLQSGTTGVCALIAGATLHVAWLGDSQVILV 211 - 280 QQGQVVKLMEPHRPERQDEKARIEALGGFVSHMDCWRVNGTLAVSRAIGDVFQKPYVSGEADAASRALTG 281 - 350 SEDYLLLACDGFFDVVPHQEVVGLVQSHLTRQQGSGLRVAEELVAAARERGSHDNITVMVVFLRDPQELL 351 - 420 EGGNQGEGDPQAEGRRQDLPSSLPEPETQAPPRS 421 - 454 //
| PMID | Year | Title | |
|---|---|---|---|
| 26498692 | 2015 | miR-149 represses metastasis of hepatocellular carcinoma by targeting actin-regulatory proteins PPM1F. | |
| 24338362 | 2014 | POPX2 phosphatase regulates the KIF3 kinesin motor complex. | |
| 23621870 | 2013 | Integrative transcriptome and proteome study to identify the signaling network regulated by POPX2 phosphatase. | |
| 23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. | |
| 22743349 | 2012 | Regulation of Ca(2+)/calmodulin-dependent protein kinase phosphatase (CaMKP) by oxidation/reduction at Cys-359. | |
| 22144583 | 2012 | MicroRNA-200c represses migration and invasion of breast cancer cells by targeting actin-regulatory proteins FHOD1 and PPM1F. | |
| 21656682 | 2011 | Investigation of POPX2 phosphatase functions by comparative phosphoproteomic analysis. | |
| 21269460 | 2011 | Initial characterization of the human central proteome. | |
| 20801214 | 2011 | Ppm1E is an in cellulo AMP-activated protein kinase phosphatase. | |
| 20379614 | Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. | ||
| 20068231 | 2010 | Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. | |
| 20016286 | 2010 | The POPX2 phosphatase regulates cancer cell motility and invasiveness. | |
| 18839057 | 2008 | Molecular genetics of adult ADHD: converging evidence from genome-wide association and extended pedigree linkage studies. | |
| 18230650 | 2008 | Functional interactions between phosphatase POPX2 and mDia modulate RhoA pathways. | |
| 16959974 | 2006 | The consensus coding sequences of human breast and colorectal cancers. | |
| 16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. | |
| 15140879 | 2004 | Regulation of the multifunctional Ca2+/calmodulin-dependent protein kinase II by the PP2C phosphatase PPM1F in fibroblasts. | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12539042 | 2003 | HIV-1 Tat reprograms immature dendritic cells to express chemoattractants for activated T cells and macrophages. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 11864573 | 2002 | The p21-activated kinase PAK is negatively regulated by POPX1 and POPX2, a pair of serine/threonine phosphatases of the PP2C family. | |
| 11559703 | 2001 | The Caenorhabditis elegans sex-determining protein FEM-2 and its human homologue, hFEM-2, are Ca2+/calmodulin-dependent protein kinase phosphatases that promote apoptosis. | |
| 10591208 | 1999 | The DNA sequence of human chromosome 22. | |
| 10348902 | 1999 | Molecular cloning of Ca2+/calmodulin-dependent protein kinase phosphatase. | |
| 9074928 | 1997 | One-megabase sequence analysis of the human immunoglobulin lambda gene locus. | |
| 7584028 | 1994 | Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1 (supplement). | |
| 7584026 | 1994 | Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1. |
