Property Summary

NCBI Gene PubMed Count 21
PubMed Score 33.80
PubTator Score 28.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung adenocarcinoma 2714 1.2e-19
osteosarcoma 7933 1.7e-08
invasive ductal carcinoma 2950 3.6e-03

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.606 1.7e-08
lung adenocarcinoma -1.334 1.2e-19
invasive ductal carcinoma -1.300 3.6e-03

Gene RIF (11)

PMID Text
26498692 Overexpression of PPM1F is associated with metastasis of hepatocellular carcinoma.
24338362 POPX2 affects trafficking by determining the phosphorylation status of KIF3A at serine 690.
23621870 POPX2 might regulate cell motility through its regulation of the MAPK1/3, leading to changes in the cytoskeleton and cell motility.
22743349 hCaMKP activity is reversibly regulated by oxidation/reduction at Cys-359
22144583 FHOD1 and PPM1F (direct regulators of the actin cytoskeleton) were identified as novel targets of miR-200c. Expression levels of FHOD1 and PPM1F were inversely correlated with miR-200c level in breast cancer cell lines and breast cancer patient samples.
21656682 Data identify a biochemical pathway through which POPX2 exerts its apparent cellular function: the regulation of activity of glycogen synthase kinase-3, which in turn modulates extracellular signal-regulated kinase and cell motility.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20016286 The POPX2 phosphatase regulates cancer cell motility and invasiveness.
15140879 PPM1F plays a key role in the regulation of CaMKII intracellularly
12539042 Microarray analysis indicates HIV-1 Tat downregulates the expression of many proteins, including protein phosphatase 1F (KIAA0015), in immature dendritic cells, an effect that likely facilitates the expansion of HIV-1 infection
11864573 The p21-activated kinase PAK is negatively regulated by POPX1 and POPX2, a pair of serine/threonine phosphatases of the PP2C family. (POPX1; POPX2)

AA Sequence

MSSGAPQKSSPMASGAEETPGFLDTLLQDFPALLNPEDPLPWKAPGTVLSQEEVEGELAELAMGFLGSRK      1 - 70
APPPLAAALAHEAVSQLLQTDLSEFRKLPREEEEEEEDDDEEEKAPVTLLDAQSLAQSFFNRLWEVAGQW     71 - 140
QKQVPLAARASQRQWLVSIHAIRNTRRKMEDRHVSLPSFNQLFGLSDPVNRAYFAVFDGHGGVDAARYAA    141 - 210
VHVHTNAARQPELPTDPEGALREAFRRTDQMFLRKAKRERLQSGTTGVCALIAGATLHVAWLGDSQVILV    211 - 280
QQGQVVKLMEPHRPERQDEKARIEALGGFVSHMDCWRVNGTLAVSRAIGDVFQKPYVSGEADAASRALTG    281 - 350
SEDYLLLACDGFFDVVPHQEVVGLVQSHLTRQQGSGLRVAEELVAAARERGSHDNITVMVVFLRDPQELL    351 - 420
EGGNQGEGDPQAEGRRQDLPSSLPEPETQAPPRS                                        421 - 454
//

Text Mined References (27)

PMID Year Title
26498692 2015 miR-149 represses metastasis of hepatocellular carcinoma by targeting actin-regulatory proteins PPM1F.
24338362 2014 POPX2 phosphatase regulates the KIF3 kinesin motor complex.
23621870 2013 Integrative transcriptome and proteome study to identify the signaling network regulated by POPX2 phosphatase.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22743349 2012 Regulation of Ca(2+)/calmodulin-dependent protein kinase phosphatase (CaMKP) by oxidation/reduction at Cys-359.
22144583 2012 MicroRNA-200c represses migration and invasion of breast cancer cells by targeting actin-regulatory proteins FHOD1 and PPM1F.
21656682 2011 Investigation of POPX2 phosphatase functions by comparative phosphoproteomic analysis.
21269460 2011 Initial characterization of the human central proteome.
20801214 2011 Ppm1E is an in cellulo AMP-activated protein kinase phosphatase.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20016286 2010 The POPX2 phosphatase regulates cancer cell motility and invasiveness.
18839057 2008 Molecular genetics of adult ADHD: converging evidence from genome-wide association and extended pedigree linkage studies.
18230650 2008 Functional interactions between phosphatase POPX2 and mDia modulate RhoA pathways.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15140879 2004 Regulation of the multifunctional Ca2+/calmodulin-dependent protein kinase II by the PP2C phosphatase PPM1F in fibroblasts.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12539042 2003 HIV-1 Tat reprograms immature dendritic cells to express chemoattractants for activated T cells and macrophages.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11864573 2002 The p21-activated kinase PAK is negatively regulated by POPX1 and POPX2, a pair of serine/threonine phosphatases of the PP2C family.
11559703 2001 The Caenorhabditis elegans sex-determining protein FEM-2 and its human homologue, hFEM-2, are Ca2+/calmodulin-dependent protein kinase phosphatases that promote apoptosis.
10591208 1999 The DNA sequence of human chromosome 22.
10348902 1999 Molecular cloning of Ca2+/calmodulin-dependent protein kinase phosphatase.
9074928 1997 One-megabase sequence analysis of the human immunoglobulin lambda gene locus.
7584028 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1 (supplement).
7584026 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1.