Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.51
PubTator Score 5.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.700 1.7e-02
glioblastoma -2.700 9.1e-04
posterior fossa group A ependymoma -1.700 3.9e-08
atypical teratoid / rhabdoid tumor -3.400 2.7e-05
juvenile dermatomyositis 1.050 1.1e-04
pediatric high grade glioma -2.200 2.1e-04
group 4 medulloblastoma 1.600 1.2e-03
pilocytic astrocytoma -2.300 9.8e-09
lung carcinoma 2.000 1.5e-32
Alzheimer's disease -1.300 2.6e-02
Pick disease -1.500 2.9e-04
gastric carcinoma -1.100 4.3e-02
ovarian cancer -1.800 8.0e-09
chronic rhinosinusitis -1.047 3.5e-02
cystic fibrosis and chronic rhinosinusit... -1.182 4.2e-02

Gene RIF (2)

PMID Text
20801214 The Ppm1E contributes to dephosphorylation of AMP-activated protein kinase.
11864573 The p21-activated kinase PAK is negatively regulated by POPX1 and POPX2, a pair of serine/threonine phosphatases of the PP2C family. (POPX1; POPX2)

AA Sequence

MAGCIPEEKTYRRFLELFLGEFRGPCGGGEPEPEPEPEPEPEPESEPEPEPELVEAEAAEASVEEPGEEA      1 - 70
ATVAATEEGDQEQDPEPEEEAAVEGEEEEEGAATAAAAPGHSAVPPPPPQLPPLPPLPRPLSERITPRPL     71 - 140
SERITREEVEGESLDLCLQQLYKYNCPSFLAAALARATSDEVLQSDLSAHYIPKETDGTEGTVEIETVKL    141 - 210
ARSVFSKLHEICCSWVKDFPLRRRPQLYYETSIHAIKNMRRKMEDKHVCIPDFNMLFNLEDQEEQAYFAV    211 - 280
FDGHGGVDAAIYASIHLHVNLVRQEMFPHDPAEALCRAFRVTDERFVQKAARESLRCGTTGVVTFIRGNM    281 - 350
LHVAWVGDSQVMLVRKGQAVELMKPHKPDREDEKQRIEALGGCVVWFGAWRVNGSLSVSRAIGDAEHKPY    351 - 420
ICGDADSASTVLDGTEDYLILACDGFYDTVNPDEAVKVVSDHLKENNGDSSMVAHKLVASARDAGSSDNI    421 - 490
TVIVVFLRDMNKAVNVSEESDWTENSFQGGQEDGGDDKENHGECKRPWPQHQCSAPADLGYDGRVDSFTD    491 - 560
RTSLSPGSQINVLEDPGYLDLTQIEASKPHSAQFLLPVEMFGPGAPKKANLINELMMEKKSVQSSLPEWS    561 - 630
GAGEFPTAFNLGSTGEQIYRMQSLSPVCSGLENEQFKSPGNRVSRLSHLRHHYSKKWHRFRFNPKFYSFL    631 - 700
SAQEPSHKIGTSLSSLTGSGKRNRIRSSLPWRQNSWKGYSENMRKLRKTHDIPCPDLPWSYKIE          701 - 764
//

Text Mined References (18)

PMID Year Title
23666239 2013 Meta-analysis identifies four new loci associated with testicular germ cell tumor.
23620142 2013 Genome-wide and gene-centric analyses of circulating myeloperoxidase levels in the charge and care consortia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20801214 2011 Ppm1E is an in cellulo AMP-activated protein kinase phosphatase.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17903297 2007 Genetic correlates of brain aging on MRI and cognitive test measures: a genome-wide association and linkage analysis in the Framingham Study.
17897624 2007 Inhibitors of the Ca(2+)/calmodulin-dependent protein kinase phosphatase family (CaMKP and CaMKP-N).
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16269004 2006 Post-translational excision of the carboxyl-terminal segment of CaM kinase phosphatase N and its cytosolic occurrence in the brain.
15680915 2005 Identification of major Ca(2+)/calmodulin-dependent protein kinase phosphatase-binding proteins in brain: biochemical analysis of the interaction.
15496589 2004 Identification and characterization of nuclear localization signals of CaMKP-N.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11864573 2002 The p21-activated kinase PAK is negatively regulated by POPX1 and POPX2, a pair of serine/threonine phosphatases of the PP2C family.
11726284 2001 Identification and characterization of CaMKP-N, nuclear calmodulin-dependent protein kinase phosphatase.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.