Property Summary

NCBI Gene PubMed Count 31
PubMed Score 35.08
PubTator Score 23.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis 1.600 4.0e-02
Waldenstrons macroglobulinemia 1.006 4.8e-02
posterior fossa group A ependymoma -1.400 3.9e-08
atypical teratoid / rhabdoid tumor -1.300 2.5e-03
glioblastoma -1.400 1.6e-06
medulloblastoma, large-cell -1.200 3.6e-03
hereditary spastic paraplegia -1.204 8.8e-03
adult high grade glioma -1.400 9.3e-04
group 3 medulloblastoma -1.300 3.4e-02
subependymal giant cell astrocytoma -1.098 2.6e-02
ovarian cancer -1.300 2.0e-03
dermatomyositis 1.100 1.2e-02

Gene RIF (12)

PMID Text
25631048 PPM1B interacts with Groucho 4 and is localized to DNA in a Groucho-dependent manner, and phosphatase activity is required for transcriptional silencing.
24674756 Results identify PPM1B as a critical regulator of both p38 MAPK-dependent and independent senescence pathways during normal cellular aging process.
23903585 Cadmium reversed PPM1A-induced cell cycle arrest and cadmium insensitive PPM1A mutant rescued cadmium induced cell death.
23756813 Protein kinase A activates NF-kappaB-mediated transcription by destabilization of PP2Cbeta.
23320500 the phosphatase PPM1B as a novel selective modulator of PPARgamma activity.
22750291 PPM1B functions as a TBK1 phosphatase dephosphorylates TBK1 at serine 172 and terminates TBK1-mediated IRF3 activation and IFNbeta gene expression.
22393050 Studies show that Ppm1b plays a multilayered role in regulating the availability and optimal activity of the EKLF protein in erythroid cells.
20538721 results implicate a novel and important role for PP2Cbetal in regulating hPXR activity and CYP3A4 expression by inhibiting or desensitizing signaling pathways that negatively regulate the function of pregnane X receptor in liver cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18930133 Protein phosphatase 1B is mediated dephosphorylation and inactivation of I-kappa B kinase as well as the termination of the Tumor Necrosis Factor-alpha-induced NF-kappaappaB activation.
18829461 Overexpression of PPM1A and the related PPM1B greatly reduced Cdk9 T-loop phosphorylation
14585847 PP2Cbeta down-regulates cytokine-induced NF-kappaB activation by altering IKK activity.

AA Sequence

MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGSRVANY      1 - 70
CSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMIS     71 - 140
PKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCV    141 - 210
DGKGPTEQLVSPEPEVYEILRAEEDEFIILACDGIWDVMSNEELCEYVKSRLEVSDDLENVCNWVVDTCL    211 - 280
HKGSRDNMSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNL    281 - 350
PPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRL    351 - 420
AKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI               421 - 479
//

Text Mined References (40)

PMID Year Title
25631048 2015 The Groucho-associated phosphatase PPM1B displaces Pax transactivation domain interacting protein (PTIP) to switch the transcription factor Pax2 from a transcriptional activator to a repressor.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24674756 2014 PPM1B depletion induces premature senescence in human IMR-90 fibroblasts.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23903585 2013 Cadmium is a potent inhibitor of PPM phosphatases and targets the M1 binding site.
23756813 2013 PKA negatively regulates PP2C? to activate NF-?B-mediated inflammatory signaling.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23320500 2013 The serine/threonine phosphatase PPM1B (PP2C?) selectively modulates PPAR? activity.
22781750 2012 Protein phosphatase 5 modulates SMAD3 function in the transforming growth factor-? pathway.
22750291 2012 PPM1B negatively regulates antiviral response via dephosphorylating TBK1.
22393050 2012 Functional interactions between erythroid Krüppel-like factor (EKLF/KLF1) and protein phosphatase PPM1B/PP2C?.
21269460 2011 Initial characterization of the human central proteome.
20801214 2011 Ppm1E is an in cellulo AMP-activated protein kinase phosphatase.
20538721 2010 Protein phosphatase 2Cbetal regulates human pregnane X receptor-mediated CYP3A4 gene expression in HepG2 liver carcinoma cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18930133 2009 PPM1A and PPM1B act as IKKbeta phosphatases to terminate TNFalpha-induced IKKbeta-NF-kappaB activation.
18829461 2008 Phosphatase PPM1A regulates phosphorylation of Thr-186 in the Cdk9 T-loop.
18642328 2008 Increased PAK6 expression in prostate cancer and identification of PAK6 associated proteins.
18058037 2007 Structural genomics of protein phosphatases.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17620599 2007 Functional specialization of beta-arrestin interactions revealed by proteomic analysis.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16872604 2006 Negative regulation of protein phosphatase 2Cbeta by ISG15 conjugation.
15913950 2005 The 2p21 deletion syndrome: characterization of the transcription content.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14585847 2004 Protein phosphatase 2Cbeta association with the IkappaB kinase complex is involved in regulating NF-kappaB activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12045112 2002 RNA editing by adenosine deaminases that act on RNA.
11563908 2001 Uniquely conserved non-translated regions are involved in generation of the two major transcripts of protein phosphatase 2Cbeta.
11524703 2001 A recessive contiguous gene deletion of chromosome 2p16 associated with cystinuria and a mitochondrial disease.
11104763 2001 Regulation of the TAK1 signaling pathway by protein phosphatase 2C.
10934208 2000 Dephosphorylation of human cyclin-dependent kinases by protein phosphatase type 2C alpha and beta 2 isoforms.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10580002 1999 Dephosphorylation of cyclin-dependent kinases by type 2C protein phosphatases.
10480873 1999 Protein phosphatase 2C inactivates F-actin binding of human platelet moesin.
9684878 1998 The cloning expression and tissue distribution of human PP2Cbeta.