Property Summary

NCBI Gene PubMed Count 46
PubMed Score 44.29
PubTator Score 49.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -1.500 2.6e-02
psoriasis 1.100 2.8e-04
glioblastoma -2.200 6.4e-05
osteosarcoma -3.312 7.0e-08
ependymoma -1.400 3.3e-08
atypical teratoid / rhabdoid tumor -2.100 5.7e-08
medulloblastoma, large-cell -1.700 3.4e-05
ulcerative colitis -1.121 2.5e-03
pancreatic ductal adenocarcinoma liver m... -1.441 1.3e-03
colon cancer -1.200 2.1e-02
sarcoidosis 1.300 3.6e-03
adult high grade glioma -1.900 4.9e-06
group 4 medulloblastoma 1.200 1.5e-03
pilocytic astrocytoma -1.200 3.6e-05
subependymal giant cell astrocytoma -1.772 4.9e-02
spina bifida -1.431 3.7e-02
Pick disease 1.900 4.0e-07
Breast cancer -1.100 3.2e-08
ductal carcinoma in situ -1.100 4.8e-04
invasive ductal carcinoma -1.300 7.5e-03
ovarian cancer -1.700 1.0e-06
pituitary cancer 1.100 1.7e-06

Protein-protein Interaction (10)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
624438 confirmatory 0 / 0 / 1 Late stage assay provider counterscreen for the probe development effort to identify inhibitors of PP5: fluorescence-based biochemical dose response assay to determine activity of inhibitors on dephosphorylation of OMFP by PP2C-alpha (Round 5)

Gene RIF (20)

PMID Text
25815785 findings demonstrate a novel regulatory circuit in which STING and TBK1 reciprocally regulate each other to enable efficient antiviral signaling activation, and PPM1A dephosphorylates STING and TBK1
25026293 Loss of PPM1A is associated with the development of tumor invasion in bladder cancer patients.
24901250 The TGF-beta/Smad signaling system decreases its activity through strong negative regulation. We provide evidence for a new negative feedback loop through PPM1A upregulation.
23906386 phosphatase activity toward phosphopeptide substrates by PP2Calpha and Wip1 requires the binding of a Mg(2)+ ion to the low-affinity site.
23812431 PPM1A is a RelA phosphatase that regulates NF-kappaB activity and that PPM1A has tumor suppressor-like activity.
23779087 a nuclear envelope-localized mechanism of inactivating TGF-beta signaling in which MAN1 competes with transcription factors for binding to Smad2 and Smad3 and facilitates their dephosphorylation by PPM1A.
23560844 PPM1A negatively regulates ERK by directly dephosphorylating its pThr202 position early in epidermal growth factor stimulation. Additional kinetic studies reveal that key residues participate in phospho-ERK recognition by PPM1A.
22727189 PPM1A inhibits HIV-1 infection and gene expression. PPM1A depletion in resting CD4+ T cells increases HIV-1 gene expression.
22727189 Knockdown of protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A) by siRNA ehnahces HIV-1 gene expression in resting CD4+ T cells
22519956 Studies indicate that phosphatase PPM1G is a component of the spliceosome and binds to protein YB-1 to affect alternative splicing.
22041443 High expression of LMP2 and low expression of PPM1A might play an important role in the motility and invasiveness of trophoblast cells and malignant transformation of hydatidiform mole.
20970119 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19404668 The present data indicate that PPM1A plays a critical role in the regulation of normal placentation by inhibiting trophoblast migration and invasion.
18930133 Protein phosphatase 1A is essential to terminate I-kappa B Kinase-mediated NF-kappaappaB activation through binding to the activated form of I-kappa B Kinase and dephosphorylating I-kappa B Kinase at the conserved residues Ser177 and Ser181.
18829461 Overexpression of PPM1A and the related PPM1B greatly reduced Cdk9 T-loop phosphorylation
18482992 PTEN abrogates TGF-beta-induced Smad2/3 phosphorylation. This study establishes a novel role for nuclear PTEN in the stabilization of PPM1A.
17729405 Aberrant location of expression/staining intensity of PTEN, PPM1A and P-Smad2 in hepatocellular carcinoma may impact disease progression.
16931515 PPM1A plays an important role in controlling BMP signaling through catalyzing Smad1 dephosphorylation
16751101 This work demonstrates that PPM1A/PP2Calpha, through dephosphorylation of Smad2/3, plays a critical role in terminating TGFbeta signaling.

AA Sequence

MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKY      1 - 70
CCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTY     71 - 140
FINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGP    141 - 210
TEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGS    211 - 280
RDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGE    281 - 350
LASKRNVIEAVYNRLNPYKNDDTDSTSTDDMW                                          351 - 382
//

Text Mined References (54)

PMID Year Title
25815785 2015 PPM1A regulates antiviral signaling by antagonizing TBK1-mediated STING phosphorylation and aggregation.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25026293 2014 Loss of PPM1A expression enhances invasion and the epithelial-to-mesenchymal transition in bladder cancer by activating the TGF-?/Smad signaling pathway.
24901250 2014 The self-limiting dynamics of TGF-? signaling in silico and in vitro, with negative feedback through PPM1A upregulation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23906386 2013 Binding of a third metal ion by the human phosphatases PP2C? and Wip1 is required for phosphatase activity.
23812431 2014 PPM1A is a RelA phosphatase with tumor suppressor-like activity.
23779087 2013 Inhibition of TGF-? signaling at the nuclear envelope: characterization of interactions between MAN1, Smad2 and Smad3, and PPM1A.
23560844 2013 Metal-dependent protein phosphatase 1A functions as an extracellular signal-regulated kinase phosphatase.
22781750 2012 Protein phosphatase 5 modulates SMAD3 function in the transforming growth factor-? pathway.
22727189 2012 Phosphatase PPM1A negatively regulates P-TEFb function in resting CD4(+) T cells and inhibits HIV-1 gene expression.
22519956 2013 Protein Ser/Thr phosphatases--the ugly ducklings of cell signalling.
22041443 2011 [Expression and significance of LMP2 and PPM1A in gestational trophoblastic disease].
22036096 2011 A genome-wide meta-analysis of genetic variants associated with allergic rhinitis and grass sensitization and their interaction with birth order.
21960005 2011 PPM1A dephosphorylates RanBP3 to enable efficient nuclear export of Smad2 and Smad3.
21269460 2011 Initial characterization of the human central proteome.
20970119 2011 Convergent animal and human evidence suggests a role of PPM1A gene in response to antidepressants.
20801214 2011 Ppm1E is an in cellulo AMP-activated protein kinase phosphatase.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20213681 2010 Strategy for comprehensive identification of human N-myristoylated proteins using an insect cell-free protein synthesis system.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19404668 2009 Protein phosphatase 1A (PPM1A) is involved in human cytotrophoblast cell invasion and migration.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18930133 2009 PPM1A and PPM1B act as IKKbeta phosphatases to terminate TNFalpha-induced IKKbeta-NF-kappaB activation.
18829461 2008 Phosphatase PPM1A regulates phosphorylation of Thr-186 in the Cdk9 T-loop.
18482992 2008 Opposite effects of dihydrosphingosine 1-phosphate and sphingosine 1-phosphate on transforming growth factor-beta/Smad signaling are mediated through the PTEN/PPM1A-dependent pathway.
17729405 2007 Expression of PTEN, PPM1A and P-Smad2 in hepatocellular carcinomas and adjacent liver tissues.
17620599 2007 Functional specialization of beta-arrestin interactions revealed by proteomic analysis.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16931515 2006 Protein serine/threonine phosphatase PPM1A dephosphorylates Smad1 in the bone morphogenetic protein signaling pathway.
16751101 2006 PPM1A functions as a Smad phosphatase to terminate TGFbeta signaling.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16541025 2006 Shugoshin collaborates with protein phosphatase 2A to protect cohesin.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15728831 2005 A protein phosphatase 2calpha-Ca2+ channel complex for dephosphorylation of neuronal Ca2+ channels phosphorylated by protein kinase C.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15016818 2004 Protein phosphatase-2C alpha as a positive regulator of insulin sensitivity through direct activation of phosphatidylinositol 3-kinase in 3T3-L1 adipocytes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14663150 2003 Protein phosphatase 2C binds selectively to and dephosphorylates metabotropic glutamate receptor 3.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12514180 2003 Cell cycle regulation and p53 activation by protein phosphatase 2C alpha.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11959144 2002 Dephosphorylation of PKCdelta by protein phosphatase 2Ac and its inhibition by nucleotides.
11559703 2001 The Caenorhabditis elegans sex-determining protein FEM-2 and its human homologue, hFEM-2, are Ca2+/calmodulin-dependent protein kinase phosphatases that promote apoptosis.
11479720 2001 Protein phosphatase 2Calpha expression in normal human tissues: an immunohistochemical study.
10644691 2000 Protein phosphatase 2Calpha dephosphorylates axin and activates LEF-1-dependent transcription.
10580002 1999 Dephosphorylation of cyclin-dependent kinases by type 2C protein phosphatases.
10480873 1999 Protein phosphatase 2C inactivates F-actin binding of human platelet moesin.
10400656 1999 Kinetic analysis of human serine/threonine protein phosphatase 2Calpha.
9707433 1998 Protein phosphatase 2Calpha inhibits the human stress-responsive p38 and JNK MAPK pathways.
9003755 1996 Crystal structure of the protein serine/threonine phosphatase 2C at 2.0 A resolution.
8386634 1993 Regulation of elongation factor-2 by multisite phosphorylation.
1311954 1992 Mammalian protein serine/threonine phosphatase 2C: cDNA cloning and comparative analysis of amino acid sequences.