Property Summary

NCBI Gene PubMed Count 13
PubMed Score 44.87
PubTator Score 54.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis -1.300 5.1e-04
osteosarcoma -2.301 4.6e-09
ependymoma -1.300 5.1e-07
glioblastoma -2.000 1.6e-05
atypical teratoid / rhabdoid tumor -2.000 1.4e-09
medulloblastoma -1.500 3.5e-04
medulloblastoma, large-cell -1.800 1.2e-05
primitive neuroectodermal tumor -1.400 1.1e-03
intraductal papillary-mucinous adenoma (... 1.100 1.7e-04
intraductal papillary-mucinous neoplasm ... 1.300 7.0e-04
adult high grade glioma -1.600 2.5e-04
pilocytic astrocytoma -1.100 4.0e-04
subependymal giant cell astrocytoma -1.251 2.5e-02
lung carcinoma 1.500 4.2e-35

Gene RIF (1)

PMID Text
21222653 Upon activation of the appropriate cell-surface receptors to stimulate PtdIns(3,4,5)P3 synthesis, human PPIP5K1 translocates from the cytoplasm to the plasma membrane.

AA Sequence

MWSLTASEGESTTAHFFLGAGDEGLGTRGIGMRPEESDSELLEDEEDEVPPEPQIIVGICAMTKKSKSKP      1 - 70
MTQILERLCRFDYLTVVILGEDVILNEPVENWPSCHCLISFHSKGFPLDKAVAYSKLRNPFLINDLAMQY     71 - 140
YIQDRREVYRILQEEGIDLPRYAVLNRDPARPEECNLIEGEDQVEVNGAVFPKPFVEKPVSAEDHNVYIY    141 - 210
YPSSAGGGSQRLFRKIGSRSSVYSPESSVRKTGSYIYEEFMPTDGTDVKVYTVGPDYAHAEARKSPALDG    211 - 280
KVERDSEGKEIRYPVMLTAMEKLVARKVCVAFKQTVCGFDLLRANGHSFVCDVNGFSFVKNSMKYYDDCA    281 - 350
KILGNTIMRELAPQFQIPWSIPTEAEDIPIVPTTSGTMMELRCVIAIIRHGDRTPKQKMKMEVKHPRFFA    351 - 420
LFEKHGGYKTGKLKLKRPEQLQEVLDITRLLLAELEKEPGGEIEEKTGKLEQLKSVLEMYGHFSGINRKV    421 - 490
QLTYYPHGVKASNEGQDPQRETLAPSLLLVLKWGGELTPAGRVQAEELGRAFRCMYPGGQGDYAGFPGCG    491 - 560
LLRLHSTFRHDLKIYASDEGRVQMTAAAFAKGLLALEGELTPILVQMVKSANMNGLLDSDGDSLSSCQHR    561 - 630
VKARLHHILQQDAPFGPEDYDQLAPTRSTSLLNSMTIIQNPVKVCDQVFALIENLTHQIRERMQDPRSVD    631 - 700
LQLYHSETLELMLQRWSKLERDFRQKSGRYDISKIPDIYDCVKYDVQHNGSLGLQGTAELLRLSKALADV    701 - 770
VIPQEYGISREEKLEIAVGFCLPLLRKILLDLQRTHEDESVNKLHPLCYLRYSRGVLSPGRHVRTRLYFT    771 - 840
SESHVHSLLSVFRYGGLLDETQDAQWQRALDYLSAISELNYMTQIVIMLYEDNTQDPLSEERFHVELHFS    841 - 910
PGVKGVEEEGSAPAGCGFRPASSENEEMKTNQGSMENLCPGKASDEPDRALQTSPQPPEGPGLPRRSPLI    911 - 980
RNRKAGSMEVLSETSSSRPGGYRLFSSSRPPTEMKQSGLGSQCTGLFSTTVLGGSSSAPNLQDYARSHGK    981 - 1050
KLPPASLKHRDELLFVPAVKRFSVSFAKHPTNGFEGCSMVPTIYPLETLHNALSLRQVSEFLSRVCQRHT   1051 - 1120
DAQAQASAALFDSMHSSQASDNPFSPPRTLHSPPLQLQQRSEKPPWYSSGPSSTVSSAGPSSPTTVDGNS   1121 - 1190
QFGFSDQPSLNSHVAEEHQGLGLLQETPGSGAQELSIEGEQELFEPNQSPQVPPMETSQPYEEVSQPCQE   1191 - 1260
VPDISQPCQDISEALSQPCQKVPDISQQCQENHDNGNHTCQEVPHISQPCQKSSQLCQKVSEEVCQLCLE   1261 - 1330
NSEEVSQPCQGVSVEVGKLVHKFHVGVGSLVQETLVEVGSPAEEIPEEVIQPYQEFSVEVGRLAQETSAI   1331 - 1400
NLLSQGIPEIDKPSQEFPEEIDLQAQEVPEEIN                                        1401 - 1433
//

Text Mined References (21)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23300138 2014 A genome wide association study of genetic loci that influence tumour biomarkers cancer antigen 19-9, carcinoembryonic antigen and ? fetoprotein and their associations with cancer risk.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21222653 2011 Receptor-dependent compartmentalization of PPIP5K1, a kinase with a cryptic polyphosphoinositide binding domain.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18981179 2009 Structural analysis and detection of biological inositol pyrophosphates reveal that the family of VIP/diphosphoinositol pentakisphosphate kinases are 1/3-kinases.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17702752 2007 Purification, sequencing, and molecular identification of a mammalian PP-InsP5 kinase that is activated when cells are exposed to hyperosmotic stress.
17690096 2007 Cloning and characterization of two human VIP1-like inositol hexakisphosphate and diphosphoinositol pentakisphosphate kinases.
17568003 2007 Structured RNAs in the ENCODE selected regions of the human genome.
17412958 2007 A conserved family of enzymes that phosphorylate inositol hexakisphosphate.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16110330 2005 Recognition of unknown conserved alternatively spliced exons.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12825070 2003 CATSPER2, a human autosomal nonsyndromic male infertility gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.