Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.57
PubTator Score 11.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma 1.300 3.1e-02
oligodendroglioma 1.200 4.4e-02
osteosarcoma -1.107 1.8e-06
medulloblastoma, large-cell 1.600 4.4e-05
intraductal papillary-mucinous adenoma (... 1.700 2.7e-03
intraductal papillary-mucinous carcinoma... 1.400 5.2e-03

Gene RIF (3)

PMID Text
19669607 common genetic variation in the BACE1-interacting proteins, RTN3 an PPIL2, does not influence platelet b-secretase activity or susceptibility to Alzheimer's disease in this population.
19669607 Observational study of gene-disease association. (HuGE Navigator)
15946952 cyclophilin 60 regulates cell surface expression of CD147/EMMPRIN

AA Sequence

MGKRQHQKDKMYITCAEYTHFYGGKKPDLPQTNFRRLPFDHCSLSLQPFVYPVCTPDGIVFDLLNIVPWL      1 - 70
KKYGTNPSNGEKLDGRSLIKLNFSKNSEGKYHCPVLFTVFTNNTHIVAVRTTGNVYAYEAVEQLNIKAKN     71 - 140
FRDLLTDEPFSRQDIITLQDPTNLDKFNVSNFYHVKNNMKIIDPDEEKAKQDPSYYLKNTNAETRETLQE    141 - 210
LYKEFKGDEILAATMKAPEKKKVDKLNAAHYSTGKVSASFTSTAMVPETTHEAAAIDEDVLRYQFVKKKG    211 - 280
YVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPF    281 - 350
KDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTD    351 - 420
RPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKVAPETKVKSSQPQAGSQGPQTFRQGVGKYINPAATK    421 - 490
RAAEEEPSTSATVPMSKKKPSRGFGDFSSW                                            491 - 520
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21269460 2011 Initial characterization of the human central proteome.
19669607 2009 Variation in RTN3 and PPIL2 genes does not influence platelet membrane beta-secretase activity or susceptibility to alzheimer's disease in the northern Irish population.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15946952 2005 Cell surface expression of CD147/EMMPRIN is regulated by cyclophilin 60.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15189447 2004 Interaction of U-box-type ubiquitin-protein ligases (E3s) with molecular chaperones.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11435423 2001 U box proteins as a new family of ubiquitin-protein ligases.
10591208 1999 The DNA sequence of human chromosome 22.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8660300 1996 Identification of a nuclear-specific cyclophilin which interacts with the proteinase inhibitor eglin c.