Property Summary

NCBI Gene PubMed Count 15
PubMed Score 21.67
PubTator Score 11.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.500 9.2e-06
ependymoma -1.100 1.0e-02
oligodendroglioma -1.100 6.1e-03
lung cancer 1.300 2.6e-03
group 3 medulloblastoma 1.200 1.6e-03
ovarian cancer 1.100 1.4e-03

Gene RIF (2)

PMID Text
22944692 Positional proteomics analysis identifies the cleavage of human peptidylprolyl isomerase H (PPIH; cyclophilin H) at amino acid residues 69-70 by the HIV-1 protease
12875835 Free and complexed cyclophilin H have virtually identical conformations suggesting that the U4/U6-60K binding site is pre-shaped and the peptidyl-prolyl-cis/trans isomerase activity is unaffected by complex formation

AA Sequence

MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIK      1 - 70
DFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVV     71 - 140
FGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM                                     141 - 177
//

Text Mined References (21)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25383878 2014 Identification of a PRPF4 loss-of-function variant that abrogates U4/U6.U5 tri-snRNP integration and is associated with retinitis pigmentosa.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21269460 2011 Initial characterization of the human central proteome.
19932913 2010 Multiple cyclophilins involved in different cellular pathways mediate HCV replication.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
16723661 2006 The network of protein-protein interactions within the human U4/U6.U5 tri-snRNP.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12907720 2003 Two protein-protein interaction sites on the spliceosome-associated human cyclophilin CypH.
12875835 2003 Crystal structure of a complex between human spliceosomal cyclophilin H and a U4/U6 snRNP-60K peptide.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11823439 2002 A cyclophilin functions in pre-mRNA splicing.
10713041 2000 Crystal structure of the human U4/U6 small nuclear ribonucleoprotein particle-specific SnuCyp-20, a nuclear cyclophilin.
9570313 1998 The 20kD protein of human [U4/U6.U5] tri-snRNPs is a novel cyclophilin that forms a complex with the U4/U6-specific 60kD and 90kD proteins.
9404889 1997 A new cyclophilin and the human homologues of yeast Prp3 and Prp4 form a complex associated with U4/U6 snRNPs.