Property Summary

NCBI Gene PubMed Count 54
PubMed Score 53.25
PubTator Score 105.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.500 3.9e-02
lung cancer 2.600 3.0e-06
aldosterone-producing adenoma -1.193 4.1e-02
ovarian cancer 1.900 1.6e-04

Gene RIF (25)

PMID Text
26387735 Results show that CypD interacts with SPG7 and VDAC to form the mitochondrial permeability transition pore complex (PTP)and its CsA-binding region is necessary for PTP formation.
26330616 The thermodynamics of binding of Cyp-40 to Hsp90 shows remarkable temperature sensitivity in the physiological temperature range.
25966197 cyclophilin-D protein could increase oxidative stress and cause endothelial cell injury and apoptosis. cyclophilin-D protein is the key factor in reactive oxygen species-induced mitochondrial damage, leading to apoptosis of endothelial cells.
25837584 Cyp-D silencing down-regulated mitochondrial transcripts initiated from the heavy strand promoter 2 [i.e., NADH dehydrogenase 1 (ND1) by 11-fold; cytochrome oxidase 1 (COX1) by 4-fold; and ATP synthase subunit 6 (ATP6) by 6.5-fold.
25445707 molecular determinants necessary for Cyclophilin D activity regulation and binding to proposed pore constituents thereby regulating the mitochondrial permeability transition pore.
25058685 Cyp40 binds to C2I in vitro and in intact cells, it also interacts with the enzyme components of iota toxin and CDT, suggesting a common principle for this toxin family.
24946211 In summary, the results of the present study provide mechanistic evidence that both apoptosis and programmed necrosis attribute to berberine's cytotoxicity in prostate cancer cells.
24343341 The p53/Cyp-D mitochondrial complexation was prevented by CsA or Cyp-D silencing.
24138221 The Photorhabdus toxins TccC3 and TccC5 interacted with Hsp90, FKBP51, Cyp40 and CypA, suggesting a role of these host cell factors in translocation and/or refolding of the ADP-ribosyltransferases.
23845906 cisplatin-induced non-apoptotic death requires mitochondria Cyp-D-p53 signaling in pancreatic cancer cells
23303179 CypD directs mitochondria-to-nuclei inflammatory gene expression in normal and tumor cells
22892127 These results suggest Cyp-D's critical role in UVB/oxidative stress-induced skin cell death.
22681779 this is the first report establishing an important role for Cyp40 in lymphoma.
22013052 Human coronavirus-induced neuronal programmed cell death required cyclophilin d but not caspase 3 caspase 9 activities.
21121808 adult viable human brain and liver mitochondria possess an active CypD-sensitive mitochondrial permeability transition
20978188 Data show that show that the molecular chaperone heat shock protein 60 (Hsp60) directly associates with cyclophilin D (CypD).
20159966 The sirtuin-3-induced inactivation of cyclophilin D causes a detachment of hexokinase II from the mitochondria that is necessary for stimulation of oxidative phosphorylation.
20023700 Data show that disruption of FKBP51 and Cyp40 in AI C4-2 cells caused only a small reduction in proliferation.
19735641 Cyclophilin D may play a role as a redox sensor in mitochondria of mammalian cells transmitting information on the redox environment to target proteins.
19228691 Cyclophilin D interacts with Bcl2 and exerts an anti-apoptotic effect
18806802 CypD-mediated mitochondrial permeability transition pore is directly linked to the cellular and synaptic perturbations observed in the pathogenesis of Alzheimer's disease.
18708059 CyP40 is found in the cell nucleus after 3-methylchloranthrene treatment and appears to promote the dioxin response element binding form of the AhR/Arnt heterodimer.
18076075 Crystal structure of human cyclophilin D in complex with its inhibitor, cyclosporin A at 0.96-A resolution, using a K133I mutant of human CypD
16650407 CyP40 chaperone function then, is localized within the linker that forms a binding cleft with potential to accommodate non-native substrates
16551620 cyclophilin D suppresses apoptotic cell death via a mitochondrial hexokinase II-dependent mechanism in cancer cells

AA Sequence

MSHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKG      1 - 70
CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFITTVPTP     71 - 140
HLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAECGELKEGDDGGIFPKDGSGDSHPDFPEDAD    141 - 210
IDLKDVDKILLITEDLKNIGNTFFKSQNWEMAIKKYAEVLRYVDSSKAVIETADRAKLQPIALSCVLNIG    211 - 280
ACKLKMSNWQGAIDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKV    281 - 350
KQKIKAQKDKEKAVYAKMFA                                                      351 - 370
//

Text Mined References (61)

PMID Year Title
26387735 2015 SPG7 Is an Essential and Conserved Component of the Mitochondrial Permeability Transition Pore.
26330616 2015 Cyclophilin40 isomerase activity is regulated by a temperature-dependent allosteric interaction with Hsp90.
25966197 2015 Influence of cyclophilin D protein expression level on endothelial cell oxidative damage resistance.
25837584 2015 Cyclophilin-D: a resident regulator of mitochondrial gene expression.
25445707 2015 Structural mechanisms of cyclophilin D-dependent control of the mitochondrial permeability transition pore.
25058685 2015 Cyclophilin-facilitated membrane translocation as pharmacological target to prevent intoxication of mammalian cells by binary clostridial actin ADP-ribosylated toxins.
24946211 2014 Mitochondrial protein cyclophilin-D-mediated programmed necrosis attributes to berberine-induced cytotoxicity in cultured prostate cancer cells.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24343341 2014 The mitochondrial cyclophilin D/p53 complexation mediates doxorubicin-induced non-apoptotic death of A549 lung cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24138221 2014 The chaperone Hsp90 and PPIases of the cyclophilin and FKBP families facilitate membrane translocation of Photorhabdus luminescens?ADP-ribosyltransferases.
23845906 2013 Cisplatin-induced non-apoptotic death of pancreatic cancer cells requires mitochondrial cyclophilin-D-p53 signaling.
23303179 2013 Cyclophilin D extramitochondrial signaling controls cell cycle progression and chemokine-directed cell motility.
23220213 2013 Cyclophilin 40 alters UVA-induced apoptosis and mitochondrial ROS generation in keratinocytes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22892127 2012 Ultra-violet B (UVB)-induced skin cell death occurs through a cyclophilin D intrinsic signaling pathway.
22681779 2012 The heat shock protein-90 co-chaperone, Cyclophilin 40, promotes ALK-positive, anaplastic large cell lymphoma viability and its expression is regulated by the NPM-ALK oncoprotein.
22013052 2012 Human coronavirus-induced neuronal programmed cell death is cyclophilin d dependent and potentially caspase dispensable.
21886157 2011 Human metabolic individuality in biomedical and pharmaceutical research.
21711559 2011 Inhibition of cyclophilins alters lipid trafficking and blocks hepatitis C virus secretion.
21269460 2011 Initial characterization of the human central proteome.
21146485 2011 Identification of cyclophilin-40-interacting proteins reveals potential cellular function of cyclophilin-40.
21121808 2011 Cyclophilin D-sensitive mitochondrial permeability transition in adult human brain and liver mitochondria.
20978188 2010 Heat shock protein 60 regulation of the mitochondrial permeability transition pore in tumor cells.
20843780 2011 Identification of rare DNA variants in mitochondrial disorders with improved array-based sequencing.
20159966 2010 Sirtuin-3 deacetylation of cyclophilin D induces dissociation of hexokinase II from the mitochondria.
20037589 2010 A genome-wide perspective of genetic variation in human metabolism.
20023700 2010 FKBP51 and Cyp40 are positive regulators of androgen-dependent prostate cancer cell growth and the targets of FK506 and cyclosporin A.
19932913 2010 Multiple cyclophilins involved in different cellular pathways mediate HCV replication.
19735641 2009 Redox characterization of human cyclophilin D: identification of a new mammalian mitochondrial redox sensor?
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19228691 2009 Cyclophilin D interacts with Bcl2 and exerts an anti-apoptotic effect.
18806802 2008 Cyclophilin D deficiency attenuates mitochondrial and neuronal perturbation and ameliorates learning and memory in Alzheimer's disease.
18708059 2008 Cyclophilin-40 has a cellular role in the aryl hydrocarbon receptor signaling.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18076075 2008 Crystal structure of human cyclophilin D in complex with its inhibitor, cyclosporin A at 0.96-A resolution.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16650407 2006 The chaperone function of cyclophilin 40 maps to a cleft between the prolyl isomerase and tetratricopeptide repeat domains.
16551620 2006 Suppression of apoptosis by cyclophilin D via stabilization of hexokinase II mitochondrial binding in cancer cells.
16507998 2006 Inhibition of ADP/ATP exchange in receptor-interacting protein-mediated necrosis.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15497503 2004 Interaction of the Hsp90 cochaperone cyclophilin 40 with Hsc70.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15033717 2003 Molecular interaction between cyclophilin D and adenine nucleotide translocase in cytochrome c release: does it determine whether cytochrome c release is dependent on permeability transition or not?
14729611 2004 Cyclophilin D, a component of the permeability transition-pore, is an apoptosis repressor.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14580201 2003 High affinity binding of Hsp90 is triggered by multiple discrete segments of its kinase clients.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12149099 2002 Role of critical thiol groups on the matrix surface of the adenine nucleotide translocase in the mechanism of the mitochondrial permeability transition pore.
12145316 2002 A structure-based mutational analysis of cyclophilin 40 identifies key residues in the core tetratricopeptide repeat domain that mediate binding to Hsp90.
11525244 2001 Human cyclophilin 40 is a heat shock protein that exhibits altered intracellular localization following heat shock.
11350175 2001 Functional analysis of the Hsp90-associated human peptidyl prolyl cis/trans isomerases FKBP51, FKBP52 and Cyp40.
9660753 1998 Specific binding of tetratricopeptide repeat proteins to the C-terminal 12-kDa domain of hsp90.
9659917 1998 Point mutations in v-Myb disrupt a cyclophilin-catalyzed negative regulatory mechanism.
9195923 1997 Protein phosphatase 5 is a major component of glucocorticoid receptor.hsp90 complexes with properties of an FK506-binding immunophilin.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8812478 1996 The structure and complete nucleotide sequence of the human cyclophilin 40 (PPID) gene.
8509368 1993 Cyclophilin-40, a protein with homology to the P59 component of the steroid receptor complex. Cloning of the cDNA and further characterization.
7744028 1995 Expression of human cyclophilin-40 and the effect of the His141-->Trp mutation on catalysis and cyclosporin A binding.
1544925 1992 Isolation and characterization of a 40-kDa cyclophilin-related protein.