Property Summary

Ligand Count 7
NCBI Gene PubMed Count 60
PubMed Score 58.34
PubTator Score 105.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
aldosterone-producing adenoma -1.193 4.1e-02
astrocytic glioma -1.500 3.9e-02
lung cancer 1.900 4.9e-04
ovarian cancer 1.900 1.6e-04

Protein-protein Interaction (1)

Gene RIF (31)

AA Sequence

MSHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKG      1 - 70
CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFITTVPTP     71 - 140
HLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAECGELKEGDDGGIFPKDGSGDSHPDFPEDAD    141 - 210
IDLKDVDKILLITEDLKNIGNTFFKSQNWEMAIKKYAEVLRYVDSSKAVIETADRAKLQPIALSCVLNIG    211 - 280
ACKLKMSNWQGAIDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKV    281 - 350
KQKIKAQKDKEKAVYAKMFA                                                      351 - 370
//

Text Mined References (67)

PMID Year Title