Property Summary

NCBI Gene PubMed Count 17
PubMed Score 40.01
PubTator Score 14.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
glioblastoma multiforme 1.700 6.7e-17
osteosarcoma 3.038 2.1e-04
posterior fossa group A ependymoma 3.000 4.3e-17
atypical teratoid / rhabdoid tumor 1.900 1.1e-03
primary pancreatic ductal adenocarcinoma 1.009 2.6e-03
intraductal papillary-mucinous neoplasm ... 1.200 3.0e-02
active Crohn's disease 1.012 2.2e-02
adult high grade glioma 1.700 1.4e-03
subependymal giant cell astrocytoma 2.623 1.2e-02
lung adenocarcinoma 1.205 7.8e-09
lung carcinoma -1.700 1.0e-29
Pick disease 1.100 7.4e-03
ovarian cancer 1.700 1.2e-02
pituitary cancer -1.800 7.2e-05
pancreatic cancer 1.100 4.5e-03

Synonym

Accession P45877 A4LBB5 PPIase C
Symbols CYPC

Gene

PANTHER Protein Class (1)

PDB

2ESL  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
26691022 Cyclophilin C participates in cytomegalovirus US2 protein-mediated degradation of major histocompatibility complex class I molecules.
24990953 These findings establish cyclophilin C as an ER cyclophilin, demonstrate the novel involvement of cyclophilins B and C in ER redox homeostasis

AA Sequence

MGPGPRLLLPLVLCVGLGALVFSSGAEGFRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENF      1 - 70
VALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPD     71 - 140
TNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIA    141 - 210
DW                                                                        211 - 212
//

Text Mined References (17)

PMID Year Title
26691022 2015 Cyclophilin C Participates in the US2-Mediated Degradation of Major Histocompatibility Complex Class I Molecules.
25416956 2014 A proteome-scale map of the human interactome network.
24990953 2014 Depletion of cyclophilins B and C leads to dysregulation of endoplasmic reticulum redox homeostasis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19584346 2009 Genetic variants associated with cardiac structure and function: a meta-analysis and replication of genome-wide association data.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10077627 1999 Cyclophilin C-associated protein: a normal secreted glycoprotein that down-modulates endotoxin and proinflammatory responses in vivo.
9045699 1997 Native recombinant cyclophilins A, B, and C degrade DNA independently of peptidylprolyl cis-trans-isomerase activity. Potential roles of cyclophilins in apoptosis.
8341703 1993 Cloning and characterization of cyclophilin C-associated protein: a candidate natural cellular ligand for cyclophilin C.
8031755 1994 Human cyclophilin C: primary structure, tissue distribution, and determination of binding specificity for cyclosporins.
7909608 1994 Cyclophilin B trafficking through the secretory pathway is altered by binding of cyclosporin A.
1652374 1991 Two cytoplasmic candidates for immunophilin action are revealed by affinity for a new cyclophilin: one in the presence and one in the absence of CsA.
1383094 1992 Use of an epitope-tagged cDNA library to isolate cDNAs encoding proteins with nuclear localization potential.