Property Summary

NCBI Gene PubMed Count 79
PubMed Score 177.17
PubTator Score 100.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Osteogenesis imperfecta 34 6.133 3.1
Disease Target Count Z-score Confidence
Bruck syndrome 8 3.843 1.9
Disease Target Count
Osteogenesis imperfecta 9 1

Expression

  Differential Expression (20)

Gene RIF (47)

PMID Text
26774171 Over-expression of CypB enhances HIV infection by increasing nuclear import of viral DNA.
26634552 This study enhances our knowledge about the mutational pattern of the LEPRE1, CRTAP, and PPIB genes. LEPRE1 should be the first gene analyzed in mutation detection studies in patients with recessive OI.
26125731 Cyclophilin B has a high diagnostic value for stomach cancer and its downregulation can effectively inhibit the growth of stomach cancer cells. Thus, cyclophilin B may be a potential therapeutic target for stomach cancer treatment
25505242 The interaction of HIV-1 CA with human cellular peptidylprolyl isomerase B (PPIB, cyclophilin B) is identified by yeast two-hybrid screen
24990953 These findings establish cyclophilin C as an ER cyclophilin, demonstrate the novel involvement of cyclophilins B and C in ER redox homeostasis
24713575 The extracellular portion of cyclophilin B probably plays an important role in human diseases associated with acute or chronic inflammation
24583282 Cyclophilin B is a novel MDM2 interacting partner.
24272483 cyclophilin B (CypB) is a prolyl isomerase residing in the endoplasmic reticulum (ER), that provides an essential survival signal in glioblastoma multiforme cells through myc and mutant p53
24270407 Findings demonstrate that CypB prevents hypoxia-induced cell death through modulation of ubiquitin-mediated CHOP protein degradation, suggesting that CypB may have an important role in the tight regulation of CHOP under hypoxia.
24043621 An additional function of the rough endoplasmic reticulum protein complex prolyl 3-hydroxylase 1.cartilage-associated protein.cyclophilin B: the CXXXC motif reveals disulfide isomerase activity in vitro.
23144461 Cyclophilin B activity regulated secretion and activity of ADAMTS13.
22798670 these findings suggest an unexpected role for cyclophilin B in attenuation of the responses of proinflammatory macrophages
22555451 CypB has an essential function in protecting hepatoma cells against oxidative stress through binding to CD147 and regulating the ERK pathway
22484812 Cyclophilin B is a candidate pancreatic cancer biomarker.
22426501 CypB interacts with these proteins and is involved in ribosome biogenesis and RNA transcription.
22205628 First report of a unique, multicomponent, high-capacity milk fat reservoir of prolactin as a bilayer-bound complex with cyclophilins A and B in human milk.
22174317 The interaction of HIV-1 CA with human cellular peptidylprolyl isomerase B (PPIB, cyclophilin B) is identified by yeast two-hybrid screen
21748762 CypB induced by hypoxia stimulates the survival of hepatocellular carcinoma via a positive feedback loop with HIF-1alpha.
21559518 CAHL is a CsA associated helicase-like protein, which would form trimer complex with cyclophilin B and NS5B of HCV
21282188 peptidylprolyl cis-trans isomerase B may be required to effectively fold the proline-rich regions of the C-terminal propeptide of procollagen
21281954 These results suggest that CypB plays a crucial role in the replication of Japanese encephalitis virus through an interaction with NS4A.
21257749 cyclophilin isoform B is likely responsible for down-regulation of carrier expression by CsA and that it does so via its chaperone activity on NaDC1 (by direct interaction) rather than its rotamase activity.
21085665 Data indicate that CypB through its interaction with Na/K-beta1 might regulate maturation and trafficking of the pump through the secretory pathway.
20801878 Results reveal the P-domain functions as a unique protein-protein interaction domain and implicate a peptidyl prolyl isomerase as a new element in the calnexin cycle.
20237142 Cyclophilin B significantly modulate prolactin-induced function in breast cancer cells, ultimately resulting in enhanced levels of prolactin-responsive gene expression, cell growth, and migration.
19940140 a regulatory mechanism in which cell type-specific expression of certain heparan sulfate sulfotransferases determines the specific binding of CyPB to target cells
19781681 PPIB mutations cause severe osteogenesis imperfecta
19503092 Data show thatCypA and CypB both play pivotal roles, yet at different signaling levels, for Stat3 activation and function.
19297321 many proline residues in NS5A-D2 form a valid substrate for the enzymatic peptidyl-prolyl cis/trans isomerase (PPIase) activity of CypA and CypB.
19056847 the enhanced expression of CypB in malignant breast epithelium may contribute to the pathogenesis of this disease
18445599 CypB is a new TRPV6 accessory protein with potential involvement in TRPV6 channel activation through its peptidyl-prolyl cis/trans isomerase activity
18187620 The interaction of HIV-1 CA with human cellular peptidylprolyl isomerase B (PPIB, cyclophilin B) is identified by yeast two-hybrid screen
18187620 Knockdown of peptidylprolyl isomerase B (PPIB; cyclophilin B) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18054915 Altogether, our results support a model whereby CyPB induces integrin-mediated adhesion via interaction with a multimolecular unit formed by the association between CD147, CD98 and beta1 integrins.
17588944 results strongly support the hypothesis that 3-O-sulfation of GlcNH2 residues could be a key modification that provides specialized HS structures for CyPB binding to responsive cells
15989969 CYPB is a functional rfegulator of hepacivirus RNA polymerase.
15764595 Cyclophilin B plays a critical role in the activation of interferon regulatory factor-3.
14729611 Inhibition of the PT-pore (ANT-1) via up-regulation of cyclophilin D plays a role in tumorigenesis
12181673 The interaction of HIV-1 CA with human cellular peptidylprolyl isomerase B (PPIB, cyclophilin B) is identified by yeast two-hybrid screen
11955071 Different regions of CyPB are involved in peripheral blood T-lymphocyte activation and imply an important physiological function for peptidylprolyl isomerase activity.
11867726 act in the context of t lymphocyte recruitment and function
11688976 calcium signaling through CD147 receptor; induces neutrophil chemotaxis
10096576 The interaction of HIV-1 CA with human cellular peptidylprolyl isomerase B (PPIB, cyclophilin B) is identified by yeast two-hybrid screen
10026140 The interaction of HIV-1 CA with human cellular peptidylprolyl isomerase B (PPIB, cyclophilin B) is identified by yeast two-hybrid screen
9546659 The interaction of HIV-1 CA with human cellular peptidylprolyl isomerase B (PPIB, cyclophilin B) is identified by yeast two-hybrid screen
9032343 The interaction of HIV-1 CA with human cellular peptidylprolyl isomerase B (PPIB, cyclophilin B) is identified by yeast two-hybrid screen
8513493 The interaction of HIV-1 CA with human cellular peptidylprolyl isomerase B (PPIB, cyclophilin B) is identified by yeast two-hybrid screen

AA Sequence

MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRIGDEDVGRVIFGLFGKTVP      1 - 70
KTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSM     71 - 140
ANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEVEKP    141 - 210
FAIAKE                                                                    211 - 216
//

Text Mined References (84)

PMID Year Title
26774171 2016 Cyclophilin B enhances HIV-1 infection.
26634552 2015 Mutational characterization of the P3H1/CRTAP/CypB complex in recessive osteogenesis imperfecta.
26125731 2015 Expression and role of cyclophilin B in stomach cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24990953 2014 Depletion of cyclophilins B and C leads to dysregulation of endoplasmic reticulum redox homeostasis.
24713575 2014 Functional aspects of extracellular cyclophilins.
24583282 2014 A systems wide mass spectrometric based linear motif screen to identify dominant in-vivo interacting proteins for the ubiquitin ligase MDM2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24272483 2014 Cyclophilin B supports Myc and mutant p53-dependent survival of glioblastoma multiforme cells.
24270407 2014 Cyclophilin B is involved in p300-mediated degradation of CHOP in tumor cell adaptation to hypoxia.
24043621 2013 An additional function of the rough endoplasmic reticulum protein complex prolyl 3-hydroxylase 1·cartilage-associated protein·cyclophilin B: the CXXXC motif reveals disulfide isomerase activity in vitro.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23144461 2012 Cyclosporin A impairs the secretion and activity of ADAMTS13 (a disintegrin and metalloprotease with thrombospondin type 1 repeat).
22798670 2012 Cyclophilin B attenuates the expression of TNF-? in lipopolysaccharide-stimulated macrophages through the induction of B cell lymphoma-3.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22665516 2012 An interaction map of endoplasmic reticulum chaperones and foldases.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22555451 2012 Release of overexpressed CypB activates ERK signaling through CD147 binding for hepatoma cell resistance to oxidative stress.
22484812 2012 Comparing human pancreatic cell secretomes by in vitro aptamer selection identifies cyclophilin B as a candidate pancreatic cancer biomarker.
22426501 2012 Spatiotemporal behavior of nuclear cyclophilin B indicates a role in RNA transcription.
22205628 2012 A major prolactin-binding complex on human milk fat globule membranes contains cyclophilins A and B: the complex is not the prolactin receptor.
21748762 2011 Role of cyclophilin B in tumorigenesis and cisplatin resistance in hepatocellular carcinoma in humans.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21559518 2011 Cyclosporin A associated helicase-like protein facilitates the association of hepatitis C virus RNA polymerase with its cellular cyclophilin B.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21282188 2011 Mutations in PPIB (cyclophilin B) delay type I procollagen chain association and result in perinatal lethal to moderate osteogenesis imperfecta phenotypes.
21281954 2011 Involvement of cyclophilin B in the replication of Japanese encephalitis virus.
21280149 2011 Dymeclin, the gene underlying Dyggve-Melchior-Clausen syndrome, encodes a protein integral to extracellular matrix and golgi organization and is associated with protein secretion pathways critical in bone development.
21269460 2011 Initial characterization of the human central proteome.
21257749 2011 Synthesis, maturation, and trafficking of human Na+-dicarboxylate cotransporter NaDC1 requires the chaperone activity of cyclophilin B.
21085665 2010 Cyclophilin B interacts with sodium-potassium ATPase and is required for pump activity in proximal tubule cells of the kidney.
20801878 2010 Structural basis of cyclophilin B binding by the calnexin/calreticulin P-domain.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20237142 2010 Cyclophilin B as a co-regulator of prolactin-induced gene expression and function in breast cancer cells.
20089953 2010 Lack of cyclophilin B in osteogenesis imperfecta with normal collagen folding.
19946888 2010 Defining the membrane proteome of NK cells.
19940140 2010 Synthesis of heparan sulfate with cyclophilin B-binding properties is determined by cell type-specific expression of sulfotransferases.
19781681 2009 PPIB mutations cause severe osteogenesis imperfecta.
19503092 2009 Cyclophilins contribute to Stat3 signaling and survival of multiple myeloma cells.
19297321 2009 Hepatitis C virus NS5A protein is a substrate for the peptidyl-prolyl cis/trans isomerase activity of cyclophilins A and B.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19056847 2009 Expression of cyclophilin B is associated with malignant progression and regulation of genes implicated in the pathogenesis of breast cancer.
18445599 2008 The human TRPV6 channel protein is associated with cyclophilin B in human placenta.
18054915 2008 Cyclophilin B induces integrin-mediated cell adhesion by a mechanism involving CD98-dependent activation of protein kinase C-delta and p44/42 mitogen-activated protein kinases.
17588944 2007 The heparin/heparan sulfate sequence that interacts with cyclophilin B contains a 3-O-sulfated N-unsubstituted glucosamine residue.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15989969 2005 Cyclophilin B is a functional regulator of hepatitis C virus RNA polymerase.
15952740 Protein profiling of human pancreatic islets by two-dimensional gel electrophoresis and mass spectrometry.
15764595 2005 Role of cyclophilin B in activation of interferon regulatory factor-3.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15095401 2004 Identification of FHOD1-binding proteins and mechanisms of FHOD1-regulated actin dynamics.
14729611 2004 Cyclophilin D, a component of the permeability transition-pore, is an apoptosis repressor.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475965 2002 A subset of chaperones and folding enzymes form multiprotein complexes in endoplasmic reticulum to bind nascent proteins.
12397072 2003 Nascent lipidated apolipoprotein B is transported to the Golgi as an incompletely folded intermediate as probed by its association with network of endoplasmic reticulum molecular chaperones, GRP94, ERp72, BiP, calreticulin, and cyclophilin B.
11997457 2002 The intranuclear prolactin/cyclophilin B complex as a transcriptional inducer.
11688976 2001 CD147 is a signaling receptor for cyclophilin B.
10935542 2000 Role of cyclophilin B in prolactin signal transduction and nuclear retrotranslocation.
10096576 1999 Human cyclophilin has a significantly higher affinity for HIV-1 recombinant p55 than p24.
10026140 1999 Maturation-induced conformational changes of HIV-1 capsid protein and identification of two high affinity sites for cyclophilins in the C-terminal domain.
9378502 1997 Distribution of cyclophilin B-binding sites in the subsets of human peripheral blood lymphocytes.
9045699 1997 Native recombinant cyclophilins A, B, and C degrade DNA independently of peptidylprolyl cis-trans-isomerase activity. Potential roles of cyclophilins in apoptosis.
9032343 1997 The hydrophobic pocket of cyclophilin is the binding site for the human immunodeficiency virus type 1 Gag polyprotein.
8513493 1993 Human immunodeficiency virus type 1 Gag protein binds to cyclophilins A and B.
8206968 1994 Characterization of surface binding sites for cyclophilin B on a human tumor T-cell line.
8197205 1994 X-ray structure of a cyclophilin B/cyclosporin complex: comparison with cyclophilin A and delineation of its calcineurin-binding domain.
7909608 1994 Cyclophilin B trafficking through the secretory pathway is altered by binding of cyclosporin A.
7829860 1995 Selective assay for CyPA and CyPB in human blood using highly specific anti-peptide antibodies.
7821789 1994 Construction of a human full-length cDNA bank.
7522304 1994 Calcium signalling in T cells stimulated by a cyclophilin B-binding protein.
2040592 1991 A novel secreted cyclophilin-like protein (SCYLP).
2000394 1991 Human cyclophilin B: a second cyclophilin gene encodes a peptidyl-prolyl isomerase with a signal sequence.
1710767 1991 An endoplasmic reticulum-specific cyclophilin.
1530944 1992 s-cyclophilin is retained intracellularly via a unique COOH-terminal sequence and colocalizes with the calcium storage protein calreticulin.
1505219 1992 Somatic cell mapping of the human cyclophilin B gene (PPIB) to chromosome 15.
1286667 1992 Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.