Property Summary

NCBI Gene PubMed Count 254
PubMed Score 833.52
PubTator Score 518.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.419 1.1e-02
juvenile dermatomyositis 1.037 1.2e-10
acute quadriplegic myopathy 1.896 6.0e-08
intraductal papillary-mucinous adenoma (... 1.300 3.3e-03
intraductal papillary-mucinous carcinoma... 1.800 8.7e-03
Breast cancer 2.000 2.9e-02
ovarian cancer 1.700 7.7e-04

Synonym

Accession P62937 A8K220 P05092 Q3KQW3 Q567Q0 Q6IBU5 Q96IX3 Q9BRU4 Q9BTY9 Q9UC61 PPIase A
Symbols CYPA
CYPH
HEL-S-69p

Gene

PANTHER Protein Class (1)

PDB

1M63   1MF8   1AK4   1AWQ   1AWR   1AWS   1AWT   1AWU   1AWV   1BCK   1CWA   1CWB   1CWC   1CWF   1CWH   1CWI   1CWJ   1CWK   1CWL   1CWM   1CWO   1FGL   1M9C   1M9D   1M9E   1M9F   1M9X   1M9Y   1MIK   1NMK   1OCA   1RMH   1VBS   1VBT   1W8L   1W8M   1W8V   1YND   1ZKF   2ALF   2CPL   2CYH   2MS4   2MZU   2N0T   2RMA   2RMB   2X25   2X2A   2X2C   2X2D   2XGY   3CYH   3CYS   3K0M   3K0N   3K0O   3K0P   3K0Q   3K0R   3ODI   3ODL   3RDD   4CYH   4IPZ   4N1M   4N1N   4N1O   4N1P   4N1Q   4N1R   4N1S   4YUG   4YUH   4YUI   4YUJ   4YUK   4YUL   4YUM   4YUN   4YUO   4YUP   5CYH   5F66   5FJB   5KUL   5KUN   5KUO   5KUQ   5KUR   5KUS   5KUU   5KUV   5KUW   5KUZ   5KV0   5KV1   5KV2   5KV3   5KV4   5KV5   5KV6   5KV7  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Protein-protein Interaction (8)

Gene RIF (285)

PMID Text
26833980 the states of phosphorylation of Cyp A by Akt can influence the progress of the cell cycle in multiple myeloma.
26792730 CsA and FK506 might interfere with selected effector T cell functions via a CrkII-, but not CrkI-dependent mechanisms.
26702934 results indicate that the PPIA SNP rs6850: A > G is associated with increased risk for elevated plasma levels of cyclophilin A and coronary artery disease in patients with and without type 2 diabetes
26414211 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
26318518 The present knowledge on the role of cyclophilin A during coronavirus replication is summarized (Review)
26281011 review of PPIA polymorphisms and what is known about their impact on the replication cycle and course of disease for different viral infections
26095851 Cyclophilin A regulates JNK/p38-MAPK signaling through its physical interaction with ASK1.
26084004 Enhanced platelet-bound CyPA is associated with hypertension and hypercholesterolemia in stable coronary artery disease patients. In patients with acute myocardial infarction platelet-bound CyPA is significantly decreased.
26008617 These results indicate a special function mode for CypA of playing more important roles in the early stage of gastric tumorigenesis.
26005854 These findings suggest that eCyPA-CD147 signaling promotes the bone marrow homing of B cell malignancies and offer a compelling rationale for exploring this axis as a therapeutic target for these malignancies.
25874870 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
25738284 Overexpression of CypA/WT protected the cells against cisplatin or H2O2-induced oxidative damage, however, the CypA/P16S mutant had no effect. These findings suggested that CypA exhibits a protective antioxidant effect
25580061 review of the role of cyclophilin A and CD147 in kidney diseases and potential implications for treatment of kidney diseases
25552928 Decrease in plasma cyclophilin A concentration at 1 month after myocardial infarction predicts better left ventricular performance and synchronicity at 6 months.
25550208 Extracellular CyPA activates platelets via cluster of differentiation 147-mediated phosphoinositid-3-kinase/Akt-signaling, leading to enhanced adhesion and thrombus formation independently of intracellular CyPA.
25445708 Cyclophilin A regulates HIV-1 replication kinetics and infectivity, modulates sensitivity to host restriction factors, and cooperates in the transit of the pre-integration complex into the nucleus of infected cells.
25420107 The poor prognosis of esophageal cancer patients was associated with high expression of CypA.
25339776 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
25296734 CypA is secreted from CCA cells and enhances cell proliferation in an autocrine/paracrine manner, at least via direct binding with CD147, which may activate the ERK1/2 and p38 MAPK signaling pathways.
25270076 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
25229650 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
25225668 The present data demonstrate that immunophilins regulate CrkII, but not CrkI activity in T cells and suggest that CsA and FK506 inhibit selected effector T cell functions via a CrkII-dependent mechanism.
25036886 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
24998431 the results indicated that the combination of ENO1 and CYPA can serve as a potential molecular marker for the early detection of NPC.
24982184 Cyclophilin A catalyzes proline isomerization by an electrostatic handle mechanism.
24979782 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
24782340 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
24713575 The extracellular portion of cyclophilin A probably plays an important role in human diseases associated with acute or chronic inflammation.
24662981 These results suggested that,CypA, a gene downstream of HIF-1alpha, could promote the development of PDAC.
24559861 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
24525292 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
24502618 Patients with type 2 diabetes have higher circulating levels of cyclophilin A than the normal population.
24479545 These data demonstrate that, while CypA promotes reverse transcription under all conditions tested here, its effect on HIV-1 infectivity correlates more closely with effects on nuclear entry of the viral cDNA.
24479545 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
24434516 Inhibition of the AIF/CypA complex protects against intrinsic death pathways induced by oxidative stress.
24332027 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
24272759 The frequency of immunihistochemistry detected cyclophilin A protein expression was found to be equal in tumor of both histotypes.
24196714 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
24196705 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
24055605 Taken together, it is concluded that human MxB protein inhibits HIV-1 DNA integration by a CypA-dependent mechanism.
24051001 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
24036847 Data suggest that CypA expression is up-regulated in paclitaxel-resistant endometrial cancer cells; knockdown of CypA appears to reverse paclitaxel resistance suggesting possible molecular targeted therapies for endometrial cancer.
23885082 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
23558220 Simvastatin-treated patients with abdominal aortic aneurysms exert lower CyPA mRNA/protein levels and a decreased amount of phospho-ERK1/2.
23511555 we demonstrate accumulation of CPA in the culture medium after repeated blast exposures supporting the notion of extracellular CPA mediated neuroprotection
23448277 These data suggest that HIV-1 escapes restriction by TRIM5alpha through the selective disruption of CypA-dependent, TRIM5alpha-mediated inhibition of nuclear import.
23332074 Molecular dynamics simulation was used to study human cyclophilin A (CypA), in order to understand the role of enzyme motions in the catalytic mechanism and recognition.
23325683 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
23322171 Upon influenza virus infection, CypA inhibits viral replication by interacting with the M1 protein. [review]
23320071 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
23266279 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
23180369 This study shows that Cyclophilin A may initiate antiapoptotic and proapoptotic signaling in endothelial cells, especially in response to reactive oxygen species stimulation.
23152499 Hepatitis C virus NS5A-D2 site interacts with both the HCV polymerase NS5B and the host CypA.
23138189 CyPA was strongly expressed in coronary atherosclerotic plaque in patients with myocardial infarction.
23097435 These results suggest that TNPO3 and cyclophilin A facilitate HIV-1 infection by coordinating proper uncoating of the core in target cells.
23097435 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
23087682 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
23041358 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
23031673 Data indicate that cyclophilin A (CypA) inhibition correlates with the down-regulation of matrix metallopeptidase 9 (MMP9) activity.
22996014 The new prognostic biomarkers GRP78, Fructose-bisphosphate Aldolase A (ALDOA), Carbonic Anhydrase I (CA1) and Peptidyl-prolyl cis-trans isomerase A or Cyclophilin A (PPIA)) provided good survival prediction for TNM stage I-IV patients.
22944692 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
22944661 REVIEW: Cyps and their relation to the HCV viral life cycle
22930659 CYPA could possibly be used as a marker for assessing proinflammatory status and severity of vascular lesions in type 2 diabetes.
22902549 The hepatitis C virus (HCV) non-structural 5A (NS5A) protein, which is known to modulate the IFN response, competes with IRF9 for CypA binding and can prevent the formation of IRF9-CypA complexes.
22874433 Cells lacking Cyclophilin A showed more glutathionylation of other proteins than wild-type cells, suggesting that cyclophilin-regulated deglutathionylation could contribute to redox changes in HOCl/chloramine-exposed cells.
22855686 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
22814107 This review is about diverse roles of CyPA in viral infection.[Review]
22701176 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
22677509 Our results suggest that the secreted CypA plays a specific role in the signaling pathway of embryo implantation.
22580540 We identified variants in PPIA that destabilize its product, CypA, and prevent HCV infection and replication.
22492959 High Cyclophilin A is associated with pediatric diffuse intrinsic pontine glioma.
22421161 Collectively, this data reveals a novel role for cypA isomerase activity in the completion of cytokinesis and the maintenance of genome stability.
22342556 The binding motifs of p6 to Tsg-101, ALIX and Vpr coincide with binding regions and catalytic sites of p6 to CypA, suggesting a potential role of CypA in modulating functional interactions of HIV-1.
22342556 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
22301145 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
22256739 CypA protein may play an important role in the development and progression of laryngeal squamous cell carcinoma.
22238232 an important factor in cytomegalovirus IE protein expression and virus production
22205628 First report of a unique, multicomponent, high-capacity milk fat reservoir of prolactin as a bilayer-bound complex with cyclophilins A and B in human milk.
22185200 interaction of full-length HIV-1 Vpr with the host cellular factor CypA
22185200 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
22174692 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
22004035 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
21956400 These findings suggest that cyclophilin A, through its interaction with EMMPRIN, contributes to head and neck squamous cell carcinoma tumorigenesis.
21871105 CypA may represent an important new therapeutic target for liver fluke-associated cholangiocarcinoma.
21839816 Data show six differentially expressed proteins were identified as HSP70, PPIA and alpha-Enolase (up-regulated) S100-A9, PIMT and beta-5 tubulin (down-regulated), most of which had been shown to play a potential role in the pathogenesis of atherosclerosis.
21743322 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
21738476 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
21724278 Cyclophilin A represents a novel and specific marker for cardiac inflammation.
21718636 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
21667159 CypA promotes HCC cell metastasis at least partially through up-regulation of MMP3 and MMP9.
21585617 Proteomics showed that the expression of Hsp27 and cyclophilin A was upregulated in smokers, and this upregulation was particularly marked in COPD smokers.
21568899 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
21489988 CypA has in vitro peptidyl-prolyl cis/trans-isomerase activity toward some, but not all, of the peptidyl-prolyl bonds in NS5A-D3.
21464540 The interaction between CD147 and CyPA might play an important role in the process of skin aging.
21441138 treatment with CyPA induced monocyte chemotaxis in a CD147- and phosphatidylinositol 3-kinase-dependent manner
21245143 Cyclophilin A (CyPA) induces chemotaxis independent of its peptidylprolyl cis-trans isomerase activity: direct binding between CyPA and the ectodomain of CD147.
21169362 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
20962083 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
20956011 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
20946244 cyclophilin A and Hsp90 facilitate translocation of lethal factor(N) diphtheria toxin, but not of lethal factor, across endosomal membranes, and thus they function selectively in promoting translocation of certain proteins, but not of others
20920334 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
20862313 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
20796224 It could be detected that CypA is associated with tumorigenesis in TSCCs. High levels of CypA expression may predict reduced survival time.
20721640 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
20708627 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
20702630 three interlinked factors--capsid sequence, CypA levels, and TRIM5alpha--interact to determine capsid stability and therefore HIV-1 viral infectivity.
20702630 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
20553309 The expressions of cyclophilin A (CypA) and apoptosis-inducing factor (AIF) were detected in the motor neurons of ALS transgenic mice, and CypA and AIF cotranslocated to the motor neuronal nuclei.
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20454998 These results establish the relevance of CypA to glioblastoma growth in vitro and in vivo
20381070 This protein has been found differentially expressed in the anterior cingulate cortex in men patients with schizophrenia.
20364129 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
20219923 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
20139366 Cyclophilin A is a regulator of SERCA2b in human platelets.
20107018 CypA depletion of replication complex does not influence NS5A and NS5B replication complex association, arguing against a model where CypA governs hepatitis c virus replication by recruiting NS5A or NS5B into the replication complex.
20070121 Single-domain cyclophilin 18 (Cyp18) can both accelerate the rate of refolding and increase the yield of native protein during the folding reaction, i.e., function as both a folding catalyst and a chaperone.
20012529 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
20012523 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
19956261 structurally unravel interconverting substates of the human proline isomerase, cyclophilin A (CYPA, also known as PPIA)
19865066 REVIEW: potential functions of cyclophiln A and therapeutic target for human cancer
19857522 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
19825046 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
19789967 enhances the secretion of MMP-2 and MMP-9, the cell invasion, and the inflammatory cytokines production of monocytes
19758589 The CyPA/EMMPRIN activation pathway may play a relevant role in promoting the vulnerability of atherosclerotic plaques.
19741300 Results describe the action of a human HIV-1 inhibitor modeled after AoT5Cyp, constructued by fusing human CypA to human TRIM5.
19741300 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
19694548 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
19680534 Our results thus identify an unexpected correlation between HCV polyprotein processing and CypA dependence of HCV replication.
19656870 Data show that in both Jurkat and Hela cells, decreased stability of HIV-1 capsid is associated with a decrease in the efficiency of HIV-1 infection.
19656870 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
19639585 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
19625401 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
19584157 Resutls show that three of five autoantibodies, FKBP52, PPIA, and PRDX2, showed significantly increased reactivity in primary breast cancer and CIS compared with healthy controls.
19503092 Data show thatCypA and CypB both play pivotal roles, yet at different signaling levels, for Stat3 activation and function.
19457995 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
19386705 Cyclophilin A is recruited into the HCV replication complex together with NS5B. The prolyl-peptidyl isomerase motif of CyPA is essential for HCV replication.
19380579 the HCV NS5B polymerase associates with CypA via its enzymatic pocket
19328002 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
19297321 many proline residues in NS5A-D2 form a valid substrate for the enzymatic peptidyl-prolyl cis/trans isomerase (PPIase) activity of CypA and CypB.
19282959 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
19275580 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
19262010 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
19254360 Interactions between host-cell factor, CypA, and Gag strongly affect HIV-1 infectivity.
19254360 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
19205352 Its function is correlated to the structure. (review)
19185003 R55A mutant of Cyp18(CypA)is as efficient as wild type in refolding of carbonic anhydrase II; the active-site located Arg 55 is not required for catalysis of rate-limiting prolyl cis-trans isomerization steps during folding of protein substrate
19092998 The A1650G polymorphism in the regulatory region of the CypA gene may be associated with protection from HIV-1 infection.
19092998 Observational study of gene-disease association. (HuGE Navigator)
19073742 The data suggest a role for CypA in uncoating the core of HIV-1 to facilitate integration.
19073742 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
19056509 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
19020832 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
18991615 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
18829762 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
18829531 The peptidyl-prolyl isomerase (PPI) cyclophilin A (CypA), which is implicated in the regulation of protein conformation, is necessary for the prolactin (PRL)-induced activation of Jak2 and the progression of human breast cancer.
18789977 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
18704644 Data suggest that cyclophilin A is required for stabilizing N-WASP to form a N-WASP/Arp2/3 complex for the nucleation/initiation of F-actin polymerization.
18678385 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
18673375 cyclophilin-A promoter polymorphism (-11 G/C) could be associated with clinical nephrotoxicity.
18673375 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18514189 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
18421009 These data suggest that cyclophilin A may serve as a novel prognostic factor and possibly an attractive therapeutic target for endometrial carcinoma.
18417509 cyclophilin A gene was identified as the most suitable normaliser in gene expression studies involving human airway epithelial cells derived from normal, atopic and asthmatic children
18385230 reveal the molecular mechanism of cyclosporine resistance and identify CyPA as a critical cellular cofactor for HCV replication and infection
18367226 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
18321308 PPIA variation did not significantly contribute to the risk of suffering from myocardial infarction among patients with atherosclerotic diseased vessels.
18321308 Observational study of gene-disease association. (HuGE Navigator)
18212100 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
18191978 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
17991743 Data show that cyclophilin A is required for CXCR4-mediated nuclear export of heterogeneous nuclear ribonucleoprotein A2,activation and nuclear translocation of ERK1/2, and chemotactic cell migration.
17967060 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
17927958 most potent derivative binds CypA with a K(d) of 11.2+/-9.2 microM and an IC50 for activity against Caenorhabditis elegans (C. elegans) of 190 microM compared to 28 microM for cyclophilin A
17919644 CyPA acts as a potent monocyte chemoattractant and induces monocyte Il-6 release, implying a role for extracellular CyPA in the pathogenesis of atherosclerosis via activation of monocytes rather than endothelial cells
17897064 virus assembly and disassembly are attractive candidate processes for antiviral intervention; HIV-1 capsid (CA) protein and human cyclophilin A (CypA) play important roles in these processes
17897064 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
17804494 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
17715216 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
17678621 the expression of CypA and its receptor CD147 in several kinds of lung cancer cells as well as a normal lung cell and found that in H446 cell, a kind of small cell lung cancer cell, the expression are the highest
17609268 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
17590083 Observational study of gene-disease association. (HuGE Navigator)
17565686 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
17522232 Results describe a novel vif-sensitive antiviral activity of human cyclophilin A that may limit zoonotic transmission of SIV and the first demonstration of CypA encapsidation into a virus other than human immunodeficiency virus type 1.
17267487 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
17170453 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
17038183 Diverse lentiviruses, FIV and SIVagmTAN also bind to CypA.
17038183 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
16901758 cyclophilin A and G2 cell cycle arrest appear to be two independent factors important for efficient lentiviral gene transfer
16885564 Cyclophilin A is a downstream target in Fhit-mediated cessation of cell cycle progression at late G(1) phase.
16815734 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
16785541 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
16703398 PPIA, the c-myc-regulated gene is involved in genotype-C-HBV-related HCC, suggesting that c-myc is related to the hepatocarcinogenic activity of genotype-C HBV.
16643975 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
16584201 results support that Pseudomonas aeruginosa exoenzyme S ADP-ribosylates and affects the function of the cytosolic protein, CpA, with the predominant functional effect relating to interference of CpA-cellular protein interactions
16571786 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
16501094 protects HIV-1 from an unknown antiviral activity in human cells, completely independnet of TRIM5alpha
16275650 analysis of HIV-1 Gag protein interactions with cyclophilin A
16275650 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
16203999 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
16199531 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
16120388 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
15845542 The peptide FGPDLPAGD showed inhibition of the isomerase reaction and NMR chemical shift mapping experiments highlight the cyclophilin A interaction epitope
15772070 x-ray crystallographic analysis of human cyclophilin A in complex with the novel immunosuppressant sanglifehrin A
15680395 CypA substantially alters the mRNA levels of several key genes in human vascular cells, indicating potential multifunctional roles of CypA in vascular system.
15596813 affects the fate of incoming HIV-1 capsid either directly or by modulating interactions with unidentified host cell factors.
15596813 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
15388255 cyclophilin A binds CD99 and may be either a signaling mediator or a signaling regulator for CD99
15358143 Results describe the binding of severe acute respiratory syndrome coronavirus to human cyclophilin A.
15311922 identify a network of protein vibrations, extending from surface regions of the enzyme to the active site and coupled to substrate turnover. Crucial parts of this network are found to be conserved in 10 cyclophilin structures from six different species.
15229879 Interaction energy and dynamical cross-correlation calculations are used for a detailed investigation of the protein-protein interactions in the cyclophilin A-HIV-1 capsid protein complex.
15147195 Results suggest that the N-terminal domain of the capsid domain of the HIV-1 Gag precursor polyprotein is the preferential site for cyclophilin A binding.
15130913 Recombinant CyPA activated MAP kinases in cultured human umbilical vein EC & stimulated IkappaB-alpha phosphorylation, NF-kappaB activation, & adhesion molecule expression. It may play a role in the pathogenesis of inflammatory diseases.
15111303 CyPA is a novel paracrine and autocrine modulator of EC functions in immune-mediated vascular disease
14716299 CYPA and AIF cooperate in apoptosis-associated chromatinolysis.
14526201 alternative splicing and role implicated in interaction with HIV-1
12932580 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
12897779 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
12881523 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
12881522 Cyclophilin A interacts with HIV-1 Vpr and is required for its functional expression
12881522 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
12859974 Comparative molecular modeling of allergenic cyclophilin proteins, including cyclophilin A, was performed in order to investigate the structural basis of their cross-reactivity.
12810862 functional CypA required for Vesicular Stomatis Virus-New Jersey replication and infection; interacts with the nucleocapsid (N) protein of VSV-NJ and VSV-IND in infected cells, but not obligatory for the latter serotype.
12788626 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
12730686 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
12634401 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
12547912 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
12477877 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
12218175 Crystal structure of calcineurin-cyclophilin-cyclosporin shows common but distinct recognition of immunophilin-drug complexes.
12210402 Effects of gag mutations on human immunodeficiency virus type 1 particle assembly, processing, and cyclophilin A incorporation.
12210402 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
12208976 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
12181673 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
12032547 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
12009870 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
11943775 Active site residues of cyclophilin A are crucial for its signaling activity via CD147
11929983 Catalysis of cis/trans isomerization in native HIV-1 capsid by human cyclophilin A.
11929983 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
11859194 NMR relaxation methods used to characterize conformational exchange during catalysis
11836403 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
11830645 novel mode of tyrosine kinase regulation for a Tec family member and provide a molecular basis for understanding a cellular function of the ubiquitous peptidyl prolyl isomerase, CypA
11581426 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
11379967 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
11312344 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
11250896 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
10794694 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
10704338 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
10581250 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
10208939 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
10208938 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
10096576 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
10026140 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
9875332 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
9658084 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
9636359 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
9573245 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
9557731 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
9546659 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
9420228 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
9385632 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
9380739 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
9337866 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
9305737 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
9261445 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
9261419 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
9223641 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
9129655 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
9032343 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
9016720 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
8980234 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
8980222 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
8830660 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
8806510 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
8764025 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
8709190 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
8676452 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
8676442 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
8662505 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
8659916 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
8648689 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
8648687 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
8513493 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
7969495 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
7969494 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
7884893 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
7572395 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA
7543589 Viral particles containing the CA mutations, H87Q, A88P and I91V (located in the PPIA- binding site), encapsidate 30% less PPIA (CypA) into virions relative to viral particles conatining wild type CA

AA Sequence

MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRH      1 - 70
NGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVE     71 - 140
AMERFGSRNGKTSKKITIADCGQLE                                                 141 - 165
//

Text Mined References (268)

PMID Year Title
26833980 2015 Cyclophilin A as a downstream effector of PI3K/Akt signalling pathway in multiple myeloma cells.
26792730 2016 In vivo regulation of human CrkII by cyclophilin A and FK506-binding protein.
26702934 2016 PPIA rs6850: A > G single-nucleotide polymorphism is associated with raised plasma cyclophilin A levels in patients with coronary artery disease.
26318518 2015 Genetic deficiency and polymorphisms of cyclophilin A reveal its essential role for Human Coronavirus 229E replication.
26281011 2015 Cyclophilin polymorphism and virus infection.
26095851 2015 Cyclophilin A regulates JNK/p38-MAPK signaling through its physical interaction with ASK1.
26084004 2016 Platelet-bound cyclophilin A in patients with stable coronary artery disease and acute myocardial infarction.
26008617 2015 Cyclophilin A Enhances Cell Proliferation and Xenografted Tumor Growth of Early Gastric Cancer.
26005854 2015 The Cyclophilin A-CD147 complex promotes the proliferation and homing of multiple myeloma cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25833399 2015 Placental melatonin system is present throughout pregnancy and regulates villous trophoblast differentiation.
25738284 2015 Antioxidant activity is required for the protective effects of cyclophilin A against oxidative stress.
25580061 2014 The roles of CD147 and/or cyclophilin A in kidney diseases.
25556234 2015 New host factors important for respiratory syncytial virus (RSV) replication revealed by a novel microfluidics screen for interactors of matrix (M) protein.
25552928 2015 Decrease in plasma cyclophilin A concentration at 1 month after myocardial infarction predicts better left ventricular performance and synchronicity at 6 months: a pilot study in patients with ST elevation myocardial infarction.
25550208 2015 Extracellular cyclophilin A activates platelets via EMMPRIN (CD147) and PI3K/Akt signaling, which promotes platelet adhesion and thrombus formation in vitro and in vivo.
25445708 2015 The role of immunophilins in viral infection.
25420107 2015 Clinical significance of cyclophilin a expression in esophageal squamous cell carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25296734 2015 Secreted cyclophilin A mediates G1/S phase transition of cholangiocarcinoma cells via CD147/ERK1/2 pathway.
25225668 2014 Immunophilins control T lymphocyte adhesion and migration by regulating CrkII binding to C3G.
24998431 2014 Identification of candidate biomarkers for the early detection of nasopharyngeal carcinoma by quantitative proteomic analysis.
24982184 2014 Cyclophilin A catalyzes proline isomerization by an electrostatic handle mechanism.
24713575 2014 Functional aspects of extracellular cyclophilins.
24662981 2014 CypA, a gene downstream of HIF-1?, promotes the development of PDAC.
24502618 2014 Plasma level of cyclophilin A is increased in patients with type 2 diabetes mellitus and suggests presence of vascular disease.
24479545 2014 Cyclophilin A promotes HIV-1 reverse transcription but its effect on transduction correlates best with its effect on nuclear entry of viral cDNA.
24434516 2014 Inhibition of the AIF/CypA complex protects against intrinsic death pathways induced by oxidative stress.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24272759 2014 Expression of cyclophilin A in gastric adenocarcinoma patients and its inverse association with local relapses and distant metastasis.
24055605 2013 The interferon-inducible MxB protein inhibits HIV-1 infection.
24036847 2013 Knockdown of cyclophilin A reverses paclitaxel resistance in human endometrial cancer cells via suppression of MAPK kinase pathways.
23935497 2013 Rab18 binds to hepatitis C virus NS5A and promotes interaction between sites of viral replication and lipid droplets.
23558220 2013 Decreased tissue levels of cyclophilin A, a cyclosporine a target and phospho-ERK1/2 in simvastatin patients with abdominal aortic aneurysm.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23511555 Extracellular cyclophilin A protects against blast-induced neuronal injury.
23448277 2013 The V86M mutation in HIV-1 capsid confers resistance to TRIM5? by abrogation of cyclophilin A-dependent restriction and enhancement of viral nuclear import.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23332074 2013 Conformational plasticity of an enzyme during catalysis: intricate coupling between cyclophilin A dynamics and substrate turnover.
23322171 2013 Insights into the roles of cyclophilin A during influenza virus infection.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23180369 2013 Antiapoptotic and proapoptotic signaling of cyclophilin A in endothelial cells.
23152499 2012 Hepatitis C virus NS5B and host cyclophilin A share a common binding site on NS5A.
23138189 2013 Plasma cyclophilin A is a novel biomarker for coronary artery disease.
23097435 2013 The host proteins transportin SR2/TNPO3 and cyclophilin A exert opposing effects on HIV-1 uncoating.
23031673 2012 Downregulation of cyclophilin A by siRNA diminishes non-small cell lung cancer cell growth and metastasis via the regulation of matrix metallopeptidase 9.
22996014 2012 New prognosis biomarkers identified by dynamic proteomic analysis of colorectal cancer.
22944661 2012 Cyclophilin involvement in the replication of hepatitis C virus and other viruses.
22930659 2012 Proteomic profiling of high glucose primed monocytes identifies cyclophilin A as a potential secretory marker of inflammation in type 2 diabetes.
22902549 2013 HCV NS5A and IRF9 compete for CypA binding.
22874433 2012 Protein thiol oxidation and formation of S-glutathionylated cyclophilin A in cells exposed to chloramines and hypochlorous acid.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22814107 2012 Cyclophilin A and viral infections.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22677509 2012 Secreted cyclophilin A induction during embryo implantation in a model of human trophoblast-endometrial epithelium interaction.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22580540 2012 Hepatocytes that express variants of cyclophilin A are resistant to HCV infection and replication.
22492959 2012 Insights into pediatric diffuse intrinsic pontine glioma through proteomic analysis of cerebrospinal fluid.
22421161 2012 The peptidyl prolyl isomerase cyclophilin A localizes at the centrosome and the midbody and is required for cytokinesis.
22342556 2012 HIV-1 p6-Another viral interaction partner to the host cellular protein cyclophilin A.
22256739 2011 [Clinical significance of MRP8 and cypA expression in laryngeal squamous cell carcinoma tissues].
22238232 2012 Cyclophilin A is required for efficient human cytomegalovirus DNA replication and reactivation.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22205628 2012 A major prolactin-binding complex on human milk fat globule membranes contains cyclophilins A and B: the complex is not the prolactin receptor.
22185200 2011 The host-pathogen interaction of human cyclophilin A and HIV-1 Vpr requires specific N-terminal and novel C-terminal domains.
22174692 2011 HIV-1 capsid-cyclophilin interactions determine nuclear import pathway, integration targeting and replication efficiency.
21956400 2012 Cyclophilin A-EMMPRIN interaction induces invasion of head and neck squamous cell carcinoma.
21871105 2011 Cyclophilin A enhances cell proliferation and tumor growth of liver fluke-associated cholangiocarcinoma.
21839816 2011 Pentoxifylline administration changes protein expression profile of coronary artery disease patients.
21724278 2013 EMMPRIN and its ligand cyclophilin A as novel diagnostic markers in inflammatory cardiomyopathy.
21711559 2011 Inhibition of cyclophilins alters lipid trafficking and blocks hepatitis C virus secretion.
21667159 2011 Cyclophilin A promotes human hepatocellular carcinoma cell metastasis via regulation of MMP3 and MMP9.
21585617 2011 Heat shock protein 27 and cyclophilin A associate with the pathogenesis of COPD.
21489988 2011 Domain 3 of NS5A protein from the hepatitis C virus has intrinsic alpha-helical propensity and is a substrate of cyclophilin A.
21464540 2011 Expression of cyclophilin A and CD147 during skin aging.
21441138 2011 Disrupting the EMMPRIN (CD147)-cyclophilin A interaction reduces infarct size and preserves systolic function after myocardial ischemia and reperfusion.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
21245143 2011 Cyclophilin A (CyPA) induces chemotaxis independent of its peptidylprolyl cis-trans isomerase activity: direct binding between CyPA and the ectodomain of CD147.
20946244 2011 Role of CypA and Hsp90 in membrane translocation mediated by anthrax protective antigen.
20796224 2011 Increased expression of peroxiredoxin 6 and cyclophilin A in squamous cell carcinoma of the tongue.
20702630 2010 Strain-specific differences in the impact of human TRIM5alpha, different TRIM5alpha alleles, and the inhibition of capsid-cyclophilin A interactions on the infectivity of HIV-1.
20553309 2011 Apoptosis-inducing factor and cyclophilin A cotranslocate to the motor neuronal nuclei in amyotrophic lateral sclerosis model mice.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20454998 2011 Knockdown of CypA inhibits interleukin-8 (IL-8) and IL-8-mediated proliferation and tumor growth of glioblastoma cells through down-regulated NF-?B.
20381070 2010 Sex-specific proteome differences in the anterior cingulate cortex of schizophrenia.
20364129 2010 Acetylation regulates cyclophilin A catalysis, immunosuppression and HIV isomerization.
20139366 2010 SERCA2b activity is regulated by cyclophilins in human platelets.
20107018 2010 Cyclophilin A-independent recruitment of NS5A and NS5B into hepatitis C virus replication complexes.
20070121 2010 Chaperone activity of Cyp18 through hydrophobic condensation that enables rescue of transient misfolded molten globule intermediates.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19956261 2009 Hidden alternative structures of proline isomerase essential for catalysis.
19946888 2010 Defining the membrane proteome of NK cells.
19932913 2010 Multiple cyclophilins involved in different cellular pathways mediate HCV replication.
19865066 2009 Cyclophilin A: potential functions and therapeutic target for human cancer.
19789967 2010 Contribution of cyclophilin A to the regulation of inflammatory processes in rheumatoid arthritis.
19758589 2010 EMMPRIN and its ligand cyclophilin A regulate MT1-MMP, MMP-9 and M-CSF during foam cell formation.
19741300 2009 Potent inhibition of HIV-1 by TRIM5-cyclophilin fusion proteins engineered from human components.
19680534 2009 Essential role of cyclophilin A for hepatitis C virus replication and virus production and possible link to polyprotein cleavage kinetics.
19656870 2009 Target cell type-dependent modulation of human immunodeficiency virus type 1 capsid disassembly by cyclophilin A.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19584157 2009 Identification of a new panel of serum autoantibodies associated with the presence of in situ carcinoma of the breast in younger women.
19503092 2009 Cyclophilins contribute to Stat3 signaling and survival of multiple myeloma cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19386705 2009 Critical role of cyclophilin A and its prolyl-peptidyl isomerase activity in the structure and function of the hepatitis C virus replication complex.
19380579 2009 The isomerase active site of cyclophilin A is critical for hepatitis C virus replication.
19297321 2009 Hepatitis C virus NS5A protein is a substrate for the peptidyl-prolyl cis/trans isomerase activity of cyclophilins A and B.
19254360 2009 Modulation of HIV-1 infectivity and cyclophilin A-dependence by Gag sequence and target cell type.
19205352 2009 [Correlation between structure and function of peptidyl-prolyl isomerase].
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19185003 2009 A nonessential role for Arg 55 in cyclophilin18 for catalysis of proline isomerization during protein folding.
19092998 2008 Polymorphisms in the regulatory region of the Cyclophilin A gene influence the susceptibility for HIV-1 infection.
19073742 2009 Cyclophilin A levels dictate infection efficiency of human immunodeficiency virus type 1 capsid escape mutants A92E and G94D.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18829531 2008 Prolyl isomerase cyclophilin A regulation of Janus-activated kinase 2 and the progression of human breast cancer.
18704644 2009 Knockdown endogenous CypA with siRNA in U2OS cells results in disruption of F-actin structure and alters tumor phenotype.
18673375 A search for cyclophilin-A gene variants in cyclosporine A-treated renal transplanted patients.
18421009 2008 Proteomics identification of cyclophilin a as a potential prognostic factor and therapeutic target in endometrial carcinoma.
18417509 2008 Selection of housekeeping genes for real-time PCR in atopic human bronchial epithelial cells.
18385230 2008 Cyclophilin A is an essential cofactor for hepatitis C virus infection and the principal mediator of cyclosporine resistance in vitro.
18321308 2008 A search for cyclophilin-A gene (PPIA) variation and its contribution to the risk of atherosclerosis and myocardial infarction.
17991743 2008 Cyclophilin A is required for CXCR4-mediated nuclear export of heterogeneous nuclear ribonucleoprotein A2, activation and nuclear translocation of ERK1/2, and chemotactic cell migration.
17927958 2007 Structure-based discovery of a family of synthetic cyclophilin inhibitors showing a cyclosporin-A phenotype in Caenorhabditis elegans.
17919644 2008 Cyclophilin A differentially activates monocytes and endothelial cells: role of purity, activity, and endotoxin contamination in commercial preparations.
17897064 2007 HIV-1 capsid protein and cyclophilin a as new targets for anti-AIDS therapeutic agents.
17678621 2007 Cyclophilin A is upregulated in small cell lung cancer and activates ERK1/2 signal.
17590083 2007 Regulatory polymorphisms in the cyclophilin A gene, PPIA, accelerate progression to AIDS.
17522232 2007 Vif counteracts a cyclophilin A-imposed inhibition of simian immunodeficiency viruses in human cells.
17520256 2008 Oligo-microarray analysis reveals the role of cyclophilin A in drug resistance.
17449029 2007 Structure-based identification of small molecule compounds targeting cell cyclophilin A with anti-HIV-1 activity.
17038183 2006 Cyclophilin A interacts with diverse lentiviral capsids.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16901758 2006 G2 cell cycle arrest and cyclophilin A in lentiviral gene transfer.
16885564 2006 Protein expression profiling identifies cyclophilin A as a molecular target in Fhit-mediated tumor suppression.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
16703398 2006 Involvement of c-myc-regulated genes in hepatocellular carcinoma related to genotype-C hepatitis B virus.
16584201 2006 ADP-ribosylation of cyclophilin A by Pseudomonas aeruginosa exoenzyme S.
16527992 2006 Cyclophilin A is secreted by a vesicular pathway in vascular smooth muscle cells.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16501094 2006 Cyclophilin A and TRIM5alpha independently regulate human immunodeficiency virus type 1 infectivity in human cells.
16291214 2005 Retroviral DNA integration--mechanism and consequences.
16275650 2006 Altered HIV-1 Gag protein interactions with cyclophilin A (CypA) on the acquisition of H219Q and H219P substitutions in the CypA binding loop.
16273344 2005 The IA-2 interactome.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16097034 2005 Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC.
15952740 Protein profiling of human pancreatic islets by two-dimensional gel electrophoresis and mass spectrometry.
15845542 2005 Cyclophilin A binds to linear peptide motifs containing a consensus that is present in many human proteins.
15772070 2005 Structure of human cyclophilin A in complex with the novel immunosuppressant sanglifehrin A at 1.6 A resolution.
15680395 2005 Effects of cyclophilin A on cell proliferation and gene expressions in human vascular smooth muscle cells and endothelial cells.
15596813 2005 Cyclophilin interactions with incoming human immunodeficiency virus type 1 capsids with opposing effects on infectivity in human cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15388255 2004 Identification of cyclophilin A as a CD99-binding protein by yeast two-hybrid screening.
15358143 2004 Nucleocapsid protein of SARS coronavirus tightly binds to human cyclophilin A.
15311922 2004 Protein dynamics and enzymatic catalysis: investigating the peptidyl-prolyl cis-trans isomerization activity of cyclophilin A.
15229879 2004 Cis/trans isomerization in HIV-1 capsid protein catalyzed by cyclophilin A: insights from computational and theoretical studies.
15147195 2004 Catalysis and binding of cyclophilin A with different HIV-1 capsid constructs.
15130913 2004 Cyclophilin A is a proinflammatory cytokine that activates endothelial cells.
15111303 2004 Cyclophilin A as a novel biphasic mediator of endothelial activation and dysfunction.
15098018 2004 Single-strand specificity of APOBEC3G accounts for minus-strand deamination of the HIV genome.
15028279 2004 PCR isolation and cloning of novel splice variant mRNAs from known drug target genes.
14993672 2004 Enzymatic and structural characterization of non-peptide ligand-cyclophilin complexes.
14716299 2004 AIF and cyclophilin A cooperate in apoptosis-associated chromatinolysis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14630798 2004 Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.
14526201 2003 High frequency of alternative splicing of human genes participating in the HIV-1 life cycle: a model using TSG101, betaTrCP, PPIA, INI1, NAF1, and PML.
12932580 2003 The pH dependence of HIV-1 capsid assembly and its interaction with cyclophilin A.
12897779 2003 Cyclophilin A modulates the sensitivity of HIV-1 to host restriction factors.
12881523 2003 Structural characterization of the HIV-1 Vpr N terminus: evidence of cis/trans-proline isomerism.
12881522 2003 Cyclophilin A interacts with HIV-1 Vpr and is required for its functional expression.
12859974 2003 Homology modeling of allergenic cyclophilins: IgE-binding site and structural basis of cross-reactivity.
12853948 2003 The DNA sequence of human chromosome 7.
12810862 2003 Requirement for cyclophilin A for the replication of vesicular stomatitis virus New Jersey serotype.
12788626 2003 Human immunodeficiency virus type 1 capsid protein is a substrate of the retroviral proteinase while integrase is resistant toward proteolysis.
12730686 2003 Structural insights into the catalytic mechanism of cyclophilin A.
12707923 2003 Plasticity of protein expression during culture of fetal skin cells.
12668872 A novel and functional interaction between cyclophilin A and prolactin receptor.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12634401 2003 Treatment of human immunodeficiency virus type 1 virions depleted of cyclophilin A by natural endogenous reverse transcription restores infectivity.
12547912 2003 Abrogation of postentry restriction of HIV-1-based lentiviral vector transduction in simian cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12477877 2003 Human and simian immunodeficiency virus capsid proteins are major viral determinants of early, postentry replication blocks in simian cells.
12357034 2002 Crystal structure of human calcineurin complexed with cyclosporin A and human cyclophilin.
12218175 2002 Crystal structure of calcineurin-cyclophilin-cyclosporin shows common but distinct recognition of immunophilin-drug complexes.
12210730 2002 Interaction of the retinoblastoma gene product, RB, with cyclophilin A negatively affects cyclosporin-inhibited NFAT signaling.
12210402 2002 Effects of gag mutations on human immunodeficiency virus type 1 particle assembly, processing, and cyclophilin A incorporation.
12208976 2002 Three isoforms of cyclophilin A associated with human immunodeficiency virus type 1 were found by proteomics by using two-dimensional gel electrophoresis and matrix-assisted laser desorption ionization-time of flight mass spectrometry.
12207006 2002 Cyclosporin A blocks muscle differentiation by inducing oxidative stress and inhibiting the peptidyl-prolyl-cis-trans isomerase activity of cyclophilin A: cyclophilin A protects myoblasts from cyclosporin A-induced cytotoxicity.
12181673 2002 Immunophilins and HIV-1 infection.
12167617 2002 Phosphorylation-dependent interaction of the asialoglycoprotein receptor with molecular chaperones.
12091904 2002 Charting HIV's remarkable voyage through the cell: Basic science as a passport to future therapy.
12032547 2002 Structure of the N-terminal 283-residue fragment of the immature HIV-1 Gag polyprotein.
12009870 2002 Differential dependence of the infectivity of HIV-1 group O isolates on the cellular protein cyclophilin A.
11943775 2002 Active site residues of cyclophilin A are crucial for its signaling activity via CD147.
11929983 2002 Catalysis of cis/trans isomerization in native HIV-1 capsid by human cyclophilin A.
11836403 2002 trans-Complementation rescue of cyclophilin A-deficient viruses reveals that the requirement for cyclophilin A in human immunodeficiency virus type 1 replication is independent of its isomerase activity.
11830645 2002 Regulation of the tyrosine kinase Itk by the peptidyl-prolyl isomerase cyclophilin A.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11581426 2001 Cyclophilin A-independent replication of a human immunodeficiency virus type 1 isolate carrying a small portion of the simian immunodeficiency virus SIV(MAC) gag capsid region.
11379967 2001 Application of a green fluorescent fusion protein to study protein-protein interactions by electrophoretic methods.
11337467 2001 Identification and characterization of the potential promoter regions of 1031 kinds of human genes.
11312344 2001 Structural consequences of cyclophilin A binding on maturational refolding in human immunodeficiency virus type 1 capsid protein.
11250896 2001 Cyclophilin A regulates HIV-1 infectivity, as demonstrated by gene targeting in human T cells.
11058892 2000 Immunophilins: switched on protein binding domains?
10794694 2000 Design of a Gag pentapeptide analogue that binds human cyclophilin A more efficiently than the entire capsid protein: new insights for the development of novel anti-HIV-1 drugs.
10704338 2000 Proline residues in the HIV-1 NH2-terminal capsid domain: structure determinants for proper core assembly and subsequent steps of early replication.
10208939 1999 Cyclophilin A incorporation is not required for human immunodeficiency virus type 1 particle maturation and does not destabilize the mature capsid.
10208938 1999 In vitro assembly properties of wild-type and cyclophilin-binding defective human immunodeficiency virus capsid proteins in the presence and absence of cyclophilin A.
10096576 1999 Human cyclophilin has a significantly higher affinity for HIV-1 recombinant p55 than p24.
10026140 1999 Maturation-induced conformational changes of HIV-1 capsid protein and identification of two high affinity sites for cyclophilins in the C-terminal domain.
9875332 1998 Gag protein from human immunodeficiency virus type 1 assembles in the absence of cyclophilin A.
9769216 1998 X-ray structures and analysis of 11 cyclosporin derivatives complexed with cyclophilin A.
9658084 1998 Human immunodeficiency virus type 1 replication is modulated by host cyclophilin A expression levels.
9636359 1998 Cyclophilin a modulates processing of human immunodeficiency virus type 1 p55Gag: mechanism for antiviral effects of cyclosporin A.
9573245 1998 N-Terminal extension of human immunodeficiency virus capsid protein converts the in vitro assembly phenotype from tubular to spherical particles.
9557731 1998 Cryoelectron microscopic examination of human immunodeficiency virus type 1 virions with mutations in the cyclophilin A binding loop.
9420228 1998 Cells with high cyclophilin A content support replication of human immunodeficiency virus type 1 Gag mutants with decreased ability to incorporate cyclophilin A.
9385632 1997 Crystal structure of cyclophilin A complexed with a binding site peptide from the HIV-1 capsid protein.
9380739 1997 Transfer of the HIV-1 cyclophilin-binding site to simian immunodeficiency virus from Macaca mulatta can confer both cyclosporin sensitivity and cyclosporin dependence.
9337866 1997 Conformational state of a 25-mer peptide from the cyclophilin-binding loop of the HIV type 1 capsid protein.
9305737 1997 HIV protease substrate conformation: modulation by cyclophilin A.
9299338 1997 The NMR solution conformation of unligated human cyclophilin A.
9261445 1997 Active-site residues of cyclophilin A are crucial for its incorporation into human immunodeficiency virus type 1 virions.
9261419 1997 Cyclophilin A-induced alterations of human immunodeficiency virus type 1 CA protein in vitro.
9223641 1997 Molecular recognition in the HIV-1 capsid/cyclophilin A complex.
9129655 1997 The non-immunosuppressive cyclosporin A analogue SDZ NIM 811 inhibits cyclophilin A incorporation into virions and virus replication in human immunodeficiency virus type 1-infected primary and growth-arrested T cells.
9032343 1997 The hydrophobic pocket of cyclophilin is the binding site for the human immunodeficiency virus type 1 Gag polyprotein.
9016720 1997 Cyclophilin A complexed with a fragment of HIV-1 gag protein: insights into HIV-1 infectious activity.
8980234 1996 Crystal structure of human cyclophilin A bound to the amino-terminal domain of HIV-1 capsid.
8980222 1996 Absconding with the chaperone: essential cyclophilin-Gag interaction in HIV-1 virions.
8976380 1996 Assignment of cyclophilin A (PPIA) to human chromosome band 7p13by in situ hybridization.
8830660 1996 Extended binding sites of cyclophilin as revealed by the interaction with HIV-1 Gag polyprotein derived oligopeptides.
8806510 1996 Inhibition of HIV-1 replication by cyclosporine A or related compounds correlates with the ability to disrupt the Gag-cyclophilin A interaction.
8764025 1996 Cyclosporine A-resistant human immunodeficiency virus type 1 mutants demonstrate that Gag encodes the functional target of cyclophilin A.
8709190 1996 The human immunodeficiency virus type 1 capsid p2 domain confers sensitivity to the cyclophilin-binding drug SDZ NIM 811.
8676452 1996 Binding of the human immunodeficiency virus type 1 Gag polyprotein to cyclophilin A is mediated by the central region of capsid and requires Gag dimerization.
8676442 1996 Cyclophilin A is required for the replication of group M human immunodeficiency virus type 1 (HIV-1) and simian immunodeficiency virus SIV(CPZ)GAB but not group O HIV-1 or other primate immunodeficiency viruses.
8662505 1996 Structure of the amino-terminal core domain of the HIV-1 capsid protein.
8659916 1996 Interactions of HIV-1 proteins with human T-cell cyclophilin A.
8652511 1996 Crystal structure implies that cyclophilin predominantly catalyzes the trans to cis isomerization.
8648689 1996 Cyclophilin A is required for an early step in the life cycle of human immunodeficiency virus type 1 before the initiation of reverse transcription.
8648687 1996 Spontaneous mutations in the human immunodeficiency virus type 1 gag gene that affect viral replication in the presence of cyclosporins.
8513493 1993 Human immunodeficiency virus type 1 Gag protein binds to cyclophilins A and B.
8421501 1993 X-ray structure of a decameric cyclophilin-cyclosporin crystal complex.
8421500 1993 Solution structure of the cyclosporin A/cyclophilin complex by NMR.
8263916 1993 X-ray structure of a monomeric cyclophilin A-cyclosporin A crystal complex at 2.1 A resolution.
7969495 1994 Functional association of cyclophilin A with HIV-1 virions.
7969494 1994 Specific incorporation of cyclophilin A into HIV-1 virions.
7884893 1995 Mode of action of SDZ NIM 811, a nonimmunosuppressive cyclosporin A analog with activity against human immunodeficiency virus (HIV) type 1: interference with HIV protein-cyclophilin A interactions.
7829860 1995 Selective assay for CyPA and CyPB in human blood using highly specific anti-peptide antibodies.
7821789 1994 Construction of a human full-length cDNA bank.
7657784 1995 Identification of cyclophilin A from human decidual and placental tissue in the first trimester of pregnancy.
7590732 1995 Cyclophilin A, the major intracellular receptor for the immunosuppressant cyclosporin A, maps to chromosome 7p11.2-p13: four pseudogenes map to chromosomes 3, 10, 14, and 18.
7572395 1995 Cyclophilin and gag in HIV-1 replication and pathogenesis.
7543589 1995 Cyclophilin binding to the human immunodeficiency virus type 1 Gag polyprotein is mimicked by an anti-cyclosporine antibody.
3297675 1987 Complementary DNA for human T-cell cyclophilin.
2644542 1989 Peptidyl-prolyl cis-trans isomerase is the cyclosporin A-binding protein cyclophilin.
2197089 1990 Characterization of the human cyclophilin gene and of related processed pseudogenes.
2179953 1990 Cloning, expression, and purification of human cyclophilin in Escherichia coli and assessment of the catalytic role of cysteines by site-directed mutagenesis.
2001362 1991 Human and Escherichia coli cyclophilins: sensitivity to inhibition by the immunosuppressant cyclosporin A correlates with a specific tryptophan residue.
1989998 1991 Preliminary characterization of a cloned neutral isoelectric form of the human peptidyl prolyl isomerase cyclophilin.
1946361 1991 Crystal structure of recombinant human T-cell cyclophilin A at 2.5 A resolution.
1896075 1991 Structure of human cyclophilin and its binding site for cyclosporin A determined by X-ray crystallography and NMR spectroscopy.
1715516 1991 Nuclear association of a T-cell transcription factor blocked by FK-506 and cyclosporin A.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.
1560526 1992 A second origin of DNA plus-strand synthesis is required for optimal human immunodeficiency virus replication.