Property Summary

Ligand Count 104
NCBI Gene PubMed Count 269
PubMed Score 870.71
PubTator Score 518.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.896 6.0e-08
Breast cancer 2.000 2.9e-02
intraductal papillary-mucinous adenoma (... 1.300 3.3e-03
intraductal papillary-mucinous carcinoma... 1.800 8.7e-03
juvenile dermatomyositis 1.037 1.2e-10
osteosarcoma 1.419 1.1e-02
ovarian cancer -1.500 4.4e-12

PDB (119)

Gene RIF (305)

AA Sequence

MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRH      1 - 70
NGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVE     71 - 140
AMERFGSRNGKTSKKITIADCGQLE                                                 141 - 165
//

Text Mined References (285)

PMID Year Title