Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.81
PubTator Score 2.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.300 5.2e-04
ependymoma -2.500 6.9e-07
oligodendroglioma -2.100 2.9e-19
glioblastoma -3.900 2.9e-06
group 4 medulloblastoma -3.000 3.8e-05
atypical teratoid / rhabdoid tumor -4.500 1.1e-09
medulloblastoma, large-cell -3.000 2.8e-04
primitive neuroectodermal tumor -2.800 3.6e-03
pediatric high grade glioma -3.200 4.3e-07
pilocytic astrocytoma -2.100 7.6e-06
Pick disease -1.600 1.2e-03
ovarian cancer -1.400 7.3e-06
pituitary cancer -1.200 4.2e-02

Gene RIF (5)

PMID Text
23422819 3 genes identified by association study and supported by ocular expression and/or replication, UHRF1BP1L, PTPRR, and PPFIA2, are novel candidates for myopic development within the MYP3 locus that should be further studied.
21855798 Liprins can mediate assembly of target proteins into large protein complexes capable of regulating numerous cellular activities.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20174665 Screening in Jurkat T-cells with a short-hairpin-RNA (shRNA) library identifies protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 2 (PPFIA2) is important for HIV-1 replication
12119554 Liprin-alpha2 expression is downregulated by androgens in prostate cancer cells. It might play a role in androgen-responsive human prostate cancer & the loss of this gene expression might be associated with the androgen-independence.

AA Sequence

MMCEVMPTINEDTPMSQRGSQSSGSDSDSHFEQLMVNMLDERDRLLDTLRETQESLSLAQQRLQDVIYDR      1 - 70
DSLQRQLNSALPQDIESLTGGLAGSKGADPPEFAALTKELNACREQLLEKEEEISELKAERNNTRLLLEH     71 - 140
LECLVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLERVSALEEELA    141 - 210
AANQEIVALREQNVHIQRKMASSEGSTESEHLEGMEPGQKVHEKRLSNGSIDSTDETSQIVELQELLEKQ    211 - 280
NYEMAQMKERLAALSSRVGEVEQEAETARKDLIKTEEMNTKYQRDIREAMAQKEDMEERITTLEKRYLSA    281 - 350
QRESTSIHDMNDKLENELANKEAILRQMEEKNRQLQERLELAEQKLQQTMRKAETLPEVEAELAQRIAAL    351 - 420
TKAEERHGNIEERMRHLEGQLEEKNQELQRARQREKMNEEHNKRLSDTVDRLLTESNERLQLHLKERMAA    421 - 490
LEEKNVLIQESETFRKNLEESLHDKERLAEEIEKLRSELDQLKMRTGSLIEPTIPRTHLDTSAELRYSVG    491 - 560
SLVDSQSDYRTTKVIRRPRRGRMGVRRDEPKVKSLGDHEWNRTQQIGVLSSHPFESDTEMSDIDDDDRET    561 - 630
IFSSMDLLSPSGHSDAQTLAMMLQEQLDAINKEIRLIQEEKESTELRAEEIENRVASVSLEGLNLARVHP    631 - 700
GTSITASVTASSLASSSPPSGHSTPKLTPRSPAREMDRMGVMTLPSDLRKHRRKIAVVEEDGREDKATIK    701 - 770
CETSPPPTPRALRMTHTLPSSYHNDARSSLSVSLEPESLGLGSANSSQDSLHKAPKKKGIKSSIGRLFGK    771 - 840
KEKARLGQLRGFMETEAAAQESLGLGKLGTQAEKDRRLKKKHELLEEARRKGLPFAQWDGPTVVAWLELW    841 - 910
LGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRTPSGNV    911 - 980
WVTHEEMENLAAPAKTKESEEGSWAQCPVFLQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARM    981 - 1050
LDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKRLNYDRKELERRREASQHEIKDVLVWSNDRVIRWIQAI   1051 - 1120
GLREYANNILESGVHGSLIALDENFDYSSLALLLQIPTQNTQARQILEREYNNLLALGTERRLDESDDKN   1121 - 1190
FRRGSTWRRQFPPREVHGISMMPGSSETLPAGFRLTTTSGQSRKMTTDVASSRLQRLDNSTVRTYSC      1191 - 1257
//

Text Mined References (19)

PMID Year Title
25352737 2014 Electronic medical records and genomics (eMERGE) network exploration in cataract: several new potential susceptibility loci.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
23422819 2013 Association mapping of the high-grade myopia MYP3 locus reveals novel candidates UHRF1BP1L, PTPRR, and PPFIA2.
22885689 2012 Genome-wide association study of multiplex schizophrenia pedigrees.
21855798 2011 Liprin-mediated large signaling complex organization revealed by the liprin-?/CASK and liprin-?/liprin-? complex structures.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15217342 2004 The synaptic vesicle cycle.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12923177 2003 Interaction of the ERC family of RIM-binding proteins with the liprin-alpha family of multidomain proteins.
12629171 2003 Interaction between liprin-alpha and GIT1 is required for AMPA receptor targeting.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12119554 2002 Liprin-alpha2 gene, protein tyrosine phosphatase LAR interacting protein related gene, is downregulated by androgens in the human prostate cancer cell line LNCaP.
11931740 2002 Interaction between GRIP and liprin-alpha/SYD2 is required for AMPA receptor targeting.
9624153 1998 Liprins, a family of LAR transmembrane protein-tyrosine phosphatase-interacting proteins.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.