Property Summary

NCBI Gene PubMed Count 31
PubMed Score 40.20
PubTator Score 45.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Rheumatoid Arthritis 1.200 4.5e-03
pancreatic cancer 1.100 1.1e-03
ependymoma 2.100 6.0e-03
oligodendroglioma 2.000 3.9e-03
psoriasis 1.100 5.4e-04
astrocytoma 1.200 2.3e-10
glioblastoma multiforme 1.100 1.4e-10
osteosarcoma 1.663 1.8e-05
medulloblastoma, large-cell -1.200 2.3e-02
tuberculosis -1.200 1.1e-04
non-small cell lung cancer 1.540 5.0e-10
intraductal papillary-mucinous adenoma (... 1.300 5.4e-04
intraductal papillary-mucinous carcinoma... 1.300 7.9e-03
intraductal papillary-mucinous neoplasm ... 1.300 3.6e-03
lung cancer 1.500 4.6e-03
pancreatic carcinoma 1.100 1.1e-03
Pick disease 1.400 2.8e-04
gastric carcinoma 1.200 8.1e-03
ovarian cancer -2.400 1.1e-11
Gaucher disease type 1 -1.200 1.2e-02
pituitary cancer -1.100 1.4e-02
dermatomyositis 1.500 7.2e-04

Gene RIF (14)

PMID Text
26362536 HIV-1 Gag interacts with PFFIA1 as demonstrated by proximity dependent biotinylation proteomics
25492966 results suggested that PPFIA1 functioned with PP2A to promote the dephosphorylation of Kif7, triggering Kif7 localization to the tips of primary cilia and promoting Gli transcriptional activity.
24982445 Liprin-alpha1, ERC1a and LL5 also define new highly polarized and dynamic cytoplasmic structures uniquely localized near the protruding cell edge
23453270 PPFIA1 was frequently co-amplified with the Cyclin D1 gene in oral carcinomas and could present a biomarker as well as a novel target for specific gene therapy.
22295056 PPFIA1 as a potential functional candidate acute lung injury risk gene
22072677 The results of this study finding suggested that a model by which the self-assembly of SYD-2/Liprin-alpha proteins mediated by the coiled-coil LH1 domain is one of the key steps to the accumulation of presynaptic components at nascent synaptic junctions
21157931 These results suggest that an increased expression of Liprin-alpha1 in the brain may be associated with human Intractable epilepsy .
20096687 Data show that increased levels of liprin-alpha1 affected the localization of inactive, low-affinity integrins, while increasing the average size of beta1 integrin-positive focal adhesions.
19787783 Amplification of both PPFIA1 and CCND1 were significantly associated with high-grade breast cancer phenotype but were unrelated to tumor stage or nodal stage
19690048 Liprin is an essential regulator of cell motility that contributes to the effectiveness of cell-edge protrusion.
18196592 Amplification and overexpression of PPFIA1, a putative 11q13 invasion suppressor gene, is associated with head and neck squamous cell carcinoma
17419996 regulated degradation of liprinalpha1 is important for proper LAR receptor distribution, and could provide a mechanism for localized control of dendrite and synapse morphogenesis by activity and CaMKII.
16313174 liprin binds to ATP-agarose, challenged by free ATP, not by free GTP. Liprin LH region mutations inhibit liprin phosphorylation stabilized association of liprin with ATP-agarose. Suggests that liprin autophosphorylation regulates its association with LAR.
12923177 the interaction between ERC2 and liprin-alpha may be involved in the presynaptic localization of liprin-alpha and the molecular organization of presynaptic active zones

AA Sequence

MMCEVMPTISEAEGPPGGGGGHGSGSPSQPDADSHFEQLMVSMLEERDRLLDTLRETQETLALTQGKLHE      1 - 70
VGHERDSLQRQLNTALPQEFAALTKELNVCREQLLEREEEIAELKAERNNTRLLLEHLECLVSRHERSLR     71 - 140
MTVVKRQAQSPAGVSSEVEVLKALKSLFEHHKALDEKVRERLRVALERCSLLEEELGATHKELMILKEQN    141 - 210
NQKKTLTDGVLDINHEQENTPSTSGKRSSDGSLSHEEDLAKVIELQEIISKQSREQSQMKERLASLSSHV    211 - 280
TELEEDLDTARKDLIKSEEMNTKLQRDVREAMAQKEDMEERITTLEKRYLAAQREATSVHDLNDKLENEI    281 - 350
ANKDSMHRQTEDKNRQLQERLELAEQKLQQTLRKAETLPEVEAELAQRVAALSKAEERHGNIEERLRQME    351 - 420
AQLEEKNQELQRARQREKMNEEHNKRLSDTVDKLLSESNERLQLHLKERMAALEDKNSLLREVESAKKQL    421 - 490
EETQHDKDQLVLNIEALRAELDHMRLRGASLHHGRPHLGSVPDFRFPMADGHTDSYSTSAVLRRPQKGRL    491 - 560
AALRDEPSKVQTLNEQDWERAQQASVLANVAQAFESDADVSDGEDDRDTLLSSVDLLSPSGQADAHTLAM    561 - 630
MLQEQLDAINKEIRLIQEEKENTEQRAEEIESRVGSGSLDNLGRFRSMSSIPPYPASSLASSSPPGSGRS    631 - 700
TPRRIPHSPAREVDRLGVMTLLPPSREEVRDDKTTIKCETSPPSSPRALRLDRLHKGALHTVSHEDIRDI    701 - 770
RNSTGSQDGPVSNPSSSNSSQDSLHKAPKKKGIKSSIGRLFGKKEKGRPGQTGKEALGQAGVSETDNSSQ    771 - 840
DALGLSKLGGQAEKNRKLQKKHELLEEARRQGLPFAQWDGPTVVVWLELWVGMPAWYVAACRANVKSGAI    841 - 910
MSALSDTEIQREIGISNPLHRLKLRLAIQEIMSLTSPSAPPTSRTTLAYGDMNHEWIGNEWLPSLGLPQY    911 - 980
RSYFMECLVDARMLDHLTKKDLRGQLKMVDSFHRNSFQCGIMCLRRLNYDRKELERKREESQSEIKDVLV    981 - 1050
WSNDRVIRWILSIGLKEYANNLIESGVHGALLALDETFDFSALALLLQIPTQNTQARAVLEREFNNLLVM   1051 - 1120
GTDRRFDEDDDKSFRRAPSWRKKFRPKDIRGLAAGSAETLPANFRVTSSMSSPSMQPKKMQMDGNVSGTQ   1121 - 1190
RLDSATVRTYSC                                                             1191 - 1202
//

Text Mined References (41)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25492966 2014 The PPFIA1-PP2A protein complex promotes trafficking of Kif7 to the ciliary tip and Hedgehog signaling.
25416956 2014 A proteome-scale map of the human interactome network.
24982445 2014 Liprin-?1, ERC1 and LL5 define polarized and dynamic structures that are implicated in cell migration.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23453270 2013 Amplification of the PPFIA1 gene region on 11q13 in oral squamous cell carcinomas (OSCC).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22295056 2012 Genome wide association identifies PPFIA1 as a candidate gene for acute lung injury risk following major trauma.
22266902 2012 Liprin-? controls stress fiber formation by binding to mDia and regulating its membrane localization.
22072677 2011 The Liprin homology domain is essential for the homomeric interaction of SYD-2/Liprin-? protein in presynaptic assembly.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21157931 2011 Upregulation of liprin-?1 protein in the temporal neocortex of intractable epileptic patients and experimental rats.
20096687 2010 Liprin-alpha1 affects the distribution of low-affinity beta1 integrins and stabilizes their permanence at the cell surface.
19787783 2010 PPFIA1 and CCND1 are frequently coamplified in breast cancer.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19690048 2009 Liprin-alpha1 promotes cell spreading on the extracellular matrix by affecting the distribution of activated integrins.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19060904 2009 An empirical framework for binary interactome mapping.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18196592 2008 Amplification and overexpression of PPFIA1, a putative 11q13 invasion suppressor gene, in head and neck squamous cell carcinoma.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17419996 2007 Liprinalpha1 degradation by calcium/calmodulin-dependent protein kinase II regulates LAR receptor tyrosine phosphatase distribution and dendrite development.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16313174 2005 Liprin phosphorylation regulates binding to LAR: evidence for liprin autophosphorylation.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15217342 2004 The synaptic vesicle cycle.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12923177 2003 Interaction of the ERC family of RIM-binding proteins with the liprin-alpha family of multidomain proteins.
12629171 2003 Interaction between liprin-alpha and GIT1 is required for AMPA receptor targeting.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11931740 2002 Interaction between GRIP and liprin-alpha/SYD2 is required for AMPA receptor targeting.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
9624153 1998 Liprins, a family of LAR transmembrane protein-tyrosine phosphatase-interacting proteins.
8524829 1995 The LAR/PTP delta/PTP sigma subfamily of transmembrane protein-tyrosine-phosphatases: multiple human LAR, PTP delta, and PTP sigma isoforms are expressed in a tissue-specific manner and associate with the LAR-interacting protein LIP.1.
7796809 1995 The LAR transmembrane protein tyrosine phosphatase and a coiled-coil LAR-interacting protein co-localize at focal adhesions.