Property Summary

NCBI Gene PubMed Count 469
PubMed Score 687.51
PubTator Score 991.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (21)

Disease log2 FC p
nephrosclerosis -1.406 1.3e-02
interstitial lung disease -1.100 3.8e-02
malignant mesothelioma 2.500 2.0e-07
astrocytic glioma -1.300 4.5e-02
psoriasis -2.900 1.8e-03
osteosarcoma -1.136 9.6e-03
group 4 medulloblastoma -2.100 2.5e-05
atypical teratoid / rhabdoid tumor -1.300 1.9e-02
glioblastoma -1.700 4.4e-03
medulloblastoma, large-cell -2.800 1.2e-06
non-small cell lung carcinoma -1.800 1.4e-33
intraductal papillary-mucinous adenoma (... 1.700 2.6e-03
intraductal papillary-mucinous neoplasm ... 2.200 1.9e-03
lung cancer -4.200 3.2e-06
colon cancer -2.200 2.3e-06
lung adenocarcinoma -1.800 2.2e-10
pediatric high grade glioma -1.300 4.7e-03
posterior fossa group B ependymoma 1.400 5.1e-05
gastric carcinoma -1.800 4.4e-02
ulcerative colitis -2.100 1.3e-06
pituitary cancer -3.600 5.8e-10

Gene RIF (482)

PMID Text
27456910 Combined speed endurance and endurance exercise amplify the exercise-induced PGC-1alpha and PDK4 mRNA response in trained human muscle.
27436584 Suggest that neither plasma adrenaline nor muscle metabolic stress determines the magnitude of PGC-1alpha mRNA response in exercising human muscle.
27143380 Blood PGC-1alpha concentration was higher in cardiovascular disease patients than that in healthy persons, and tended to decrease with age.
27033444 Novel angiogenic agent COA-Cl induced activation of PGC-1alpha/ERRalpha/VEGF signaling pathway in fibroblasts.
27022023 Methionine was the only essential amino acid that rapidly induced PGC-1alpha acetylation through activating the GCN5 acetyltransferase.
27015186 The PPARGC1A rs8192678 GA/AA genotype and the PNPLA3 rs738409 GG genotype had an additive effect on NASH in severely obese Taiwanese patients.
26982719 results implicate niacinamide and NAD (nicotinamide adenine dinucleotide) as key effectors for achieving PGC1alpha-dependent stress resistance
26962700 This study provides important insights into the metabolic changes associated with RPE functional maturation and identifies PGC-1alpha as a potent driver of RPE mitochondrial function and antioxidant capacity.
26831453 Although primarily a nuclear protein, Sirt1 deacetylation of PPARGC1A has been extensively implicated in metabolic control and mitochondrial biogenesis, which was proposed to partially underlie Sirt1 role in caloric restriction and impacts on longevity. (Review)
26797282 our results revealed that stimulation of mitochondrial biogenesis by carvedilol resulted in functional gain of the mitochondria by showing increased oxygen consumption and mitochondrial respiratory rate.
26676891 were observed to be significantly increased in the PGC-1alpha group compared with the control group. These results indicate that PGC-1alpha is able to induce angiogenesis in hRVECs and retinas, and suggests that PGC-1alpha is a potential anti-angiogenic target in retinal neovascularization.
26665595 Hepatitis C virus infection results in WT-PGC-1alpha/L-PGC-1alpha high expression which will further lead to type 2 diabetes mellitus.[review]
26572168 changes in the protein content of PGC-1alpha, p53, and PHF20 are more strongly associated with training-induced changes in mitochondrial respiration than mitochondrial content.
26466083 PGC-1alpha mRNA significantly increased by 25.8-fold after alternate-day and 10.1-fold after consecutive-day training, while protein levels increased 1.5-1.7 fold in both protocols.
26438876 data point to PGC-1alpha as a critical repressor of HSF1-mediated transcriptional programs, a finding with possible implications both for our understanding of the full scope of metabolically regulated target genes in vivo
26427438 Data suggest that PGC-1alpha and PGC-1beta could play a role in regulating retina cell survival, and may be therapeutic targets to prevent retinal degeneration.
26386696 hepatic insulin resistance in human obesity is: advanced; BMI-correlated; and involves aPKC-activating ceramide; aPKC levels and activity; IRS-1 levels, Akt activity, and FoxO1 phosphorylation; and increases in expression/abundance of PGC-1alpha
26380295 Both PPARA and PPARGC1A regulate transcription of genes commonly regulated by glycolysis, by the antidiabetic agent metformin and by NOX, suggesting their major interplay in the control of hepatocellular carcinoma progression
26365176 Suppression of MYC and subsequent increase of PGC-1alpha were identified as key determinants for the OXPHOS dependency of CSCs, which was abolished in resistant CSC clones.
26363853 maintenance of tolerated PGC1alpha expression may offer a promising strategy for neuroprotective therapies
26317511 Study demonstrate a significant increase of the promoter methylation in Parkinson's disease midbrain tissue that is accompanied by decreased PGC-1alpha gene and protein expression.
26315270 GLP-1 increases PGC-1(alpha) expression by downregulating miR-23a in liver cells.
26244551 Data suggest that the binding, but not the internalization of photoreceptor outer segments (POS) confers protective effects on retinal pigment epithelium (RPE) cells through the alphavbeta5 integrin/focal adhesion kinase (FAK)/PGC-1alpha pathway.
26191154 PGC-1alpha deficiency exacerbates high glucose-induced apoptosis in human umbilical vein endothelial cells through activation of VADC1.
26185753 We propose that, in obese Mexican-Mestizos, the combination of alleles 482Ser in PPARGC1A and 12Pro in PPARG2 represents a reduced metabolic risk profile, even when the adiposity indexes are increased.
26123583 PGC-1alpha as a direct FoxO1 transcriptional target
26119730 PGC-1alpha expression induces oxidative stress and suppresses renal cell carcinoma tumor growth.
26117405 MicroRNA-19b/221/222 have roles in endothelial cell dysfunction via suppression of PGC-1alpha in the progression of atherosclerosis
26089547 Results emphasize PGC-1alpha-ex1b as the most exercise-responsive PGC-1alpha isoform in contracting skeletal muscle.
25982469 peristaltic pulse external pneumatic compression upregulates PGC-1alpha mRNA and endothelial nitric oxide sythase protein in human skeletal muscle tissue
25977930 both SNP rs7656250 and rs4235308 showed protective association with type 2 diabetes in Haitian Americans. In African Americans, however, rs4235308 showed significant risk association with T2D.
25928419 In the PGC-1alpha gene, rs8192673, is associated with waist circumference in subjects with type 2 diabetes mellitus.
25886402 These results indicate that the impaired binding of MEF2 to PGC-1alpha in humans with this SNP impedes exercise-induced fast-to-slow muscle fibre transformation.
25875376 Epigenetic alteration of the PPAGRC1A promoter may be one of the potential mechanisms underlying the metabolic programming in offspring exposed to intrauterine hyperglycaemia.
25808897 Review discusses the physiological importance of peroxisome proliferator activated receptor gamma coactivator 1 alpha along with a list of its activators that could prove useful as possible neuroprotectants in Parkinson's disease
25789761 Bile acids decrease SIRT1 protein expression and activity, thus promoting the deacetylation of peroxisome proliferator-activated receptor gamma, coactivator 1 alpha.
25779952 SIRT1/PGC1alpha-Dependent Increase in Oxidative Phosphorylation Supports Chemotherapy Resistance of Colon Cancer
25773007 72% of the patients had risk combination of PGC-1alpha XA and UCP2-866 XA genotypes.
25772858 Data suggest that innate cell survival mechanisms are activated in kidney cells to adapt to oxidative stress following patulin/mycotoxin exposure via up-regulation of transcription factors, PGC1a and NRF2 (nuclear factor erythroid 2-like protein).
25753246 Data suggest that PGC1A/PPARGC1A plays roles in regulation of (1) energy metabolism in adipose tissue, (2) gluconeogenesis in liver, (3) insulin resistance in skeletal muscle, and (4) insulin secretion in pancreatic beta cells. [REVIEW]
25748950 The current results suggest that the PPARGC1A Ser482 allele is associated with a higher aerobic capacity in Japanese middle-aged men.
25695395 Inhibition of PGC-1alpha or control of hyperglycemia.
25595716 miR-130a could contribute to metabolic homeostasis by dual targeting PGC1a and PPARgamma simultaneously.
25585584 PGC1alpha, whose expression is related to enhanced cell proliferation and tumorigenesis, may be a good candidate molecular target for cancer therapy.
25565653 following hindlimb unloading, PGC-1alpha overexpression was sufficient to prevent the decrease of pro-fusion proteins, activation of AMPK pathway, inducible expression of MuRF1 and atrogin1 and of authopagic factors, and muscle mass loss in response to disuse
25522631 Data indicate that Mongolian medicine cha gan beng ga dose and time-dependently increased the expression of PGC-1alpha protein in non-small cell lung cells A549.
25516445 this study revealed that breast apocrine carcinoma overexpressed PGC1alpha contributing to mitochondrial biogenesis, and also p62 protein accumulation.
25486838 the role of PGC-1alpha in the regulation of skeletal muscle metabolism
25470625 The Gly482Ser polymorphism of the peroxisome proliferator-activated receptor-gamma coactivator-1alpha is associated with type 2 diabetes
25434963 PGC-1alpha regulates ROS in multiple myeloma, and inhibition of elevated PGC-1alpha following stimulation by chemotherapy leads to a higher level of ROS by downregulating antioxidant factors, eventually enhancing the antitumor effect of bortezomib
25389293 Reduction of PGC1a levels using siRNA diminished the regulation of PPARg by relaxin
25363075 This study suggests that PGC-1alpha can ameliorate alpha-syn oligomerization and related toxicities.
25339750 PGC-1alpha is required for normal parvalbumin-positive interneuron function.
25324196 Results indicate that specific gene variants in ICAM1, PPARGC1A and MTHFR are associated with different non-proliferative diabetic retinopathy phenotypes, being likely candidates to explain different disease mechanisms underlying the different phenotypes.
25282005 Polymorphisms within the PGC-1alpha gene are associated with risk for Type 2 Diabetes.
25260493 These results provide new insights into potential cooperative roles of PINK1 and PGC-1alpha in mitochondrial fatty acid oxidation, suggesting possible regulatory roles for mitochondrial function in the pathogenesis of Alzheimer disease and diabetes.
25259918 Study describes a mechanism by which skeletal muscle PGC-1alpha1 induced by exercise training changes kynurenine metabolism and protects from stress-induced depression. Activation of the PGC-1alpha1-PPARalpha/delta pathway increases skeletal muscle kynurenine aminotransferases, enhancing conversion of kynurenine into kynurenic acid, a metabolite unable to cross the blood-brain barrier.
25243473 expression of PGC1alpha and TFAM varies between ovarian carcinoma subtypes; clear-cell carcinoma consists of undetectability of PGC1alpha/TFAM, and low ERalpha/Ki-67. high-grade serous carcinomas had a converse state of PGC1alpha/TFAM, ERalpha positivity and high Ki-67 index
25241037 Data indicate a strong correlation between peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (PPARGC1A, PGC-1alpha) expression in invasive cancer cells and the formation of distant metastases.
25204433 selective ubiquitination by specific Fbw7 isoforms represents a novel mechanism that tightly regulates cellular PGC-1alpha levels
25192891 Eight new genes, influencing mainly mitochondrial dynamics and metabolism, were found to be transcriptionally induced by signaling pathway involving PGC-1a and ERRa.
25099937 PGC-1alpha promoter activity and transcription was dramatically repressed in neuronal cells when exposed to ethanol, suggesting that ethanol blunts cAMP-->CREB signaling pathway to interfere with the transcription of PGC-1alpha.
25047750 Peroxisome proliferator-activated receptor gamma coactivator 1alpha and FoxO3A mediate chondroprotection by AMP-activated protein kinase.
25009290 PGC-1alpha drives functional angiogenesis in skeletal muscle via SPP1 induction and macrophage activation.
24996283 Our results suggest that PPAR-alpha and PPARGC1A gene variants have a strong effect on aerobic performance of elite level athletes.
24995979 Study shows that IRF4 is transcriptionally regulated by cold and cAMP in murine and human brown adipose tissue (BAT) prior to the induction of Ucp1 and that mice that overexpress IRF4 transgenically in BAT display enhanced thermogenic gene expression, energy expenditure, and cold tolerance.
24928019 The C allele of -1999C/G ( rs2946386) in the promoter region of the PPARGC1A gene is mildly associated with type 2 diabetes.
24907054 After acute moderate-intensity exercise constituted a significant share of total PGC-1alpha expression.
24837562 A very low calorie diet decreased promoter methylation of PPARGC1 A, and changed two days after gastric bypass.
24819348 our results show that the regulation of genes encoding ANT isoforms is controlled by PGC-1alpha through different transcription factors depending on cell type.
24812272 loss of viability caused by suppression of PGC1alpha in melanomas is rescued by induction of glycolysis.
24800995 Our results do not support the view that truncated PGC-1alpha coordinates exercise-induced hypertrophy in human skeletal muscle
24776744 Mice overexpressing the human PGC-1alpha genomic locus had increased levels even after transverse aortic constriction. This did not prevent mitochondrial and contractile dysfunction despite preserved myocardial vascularity.
24718382 In hypertensive patients, the PPARGC1A Gly482Ser polymorphism is associated with LV hypertrophy and diastolic dysfunction, with the presence of the Ser-Ser allele promoting these abnormalities.
24699405 Suggest age-associated decline in PGC1A-independent mito-biogenesis, insufficiently compensated by upregulation of AMPK/PGC1A-axis leading to decreased mitochondrial content and reductive overload of residual respiratory capacity.
24698981 NRIP1 is known to affect oxidative metabolism and mitochondrial biogenesis by negatively controlling mitochondrial pathways regulated by PGC-1alpha.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (PPARGC1A) in primary human brain microvascular endothelial cells
24654751 PGC-1alpha stimulated by TNF-alpha regulates aromatase expression and activity to promote local estrogen biosynthesis in ovarian endometriosis, suggesting that PGC-1alpha is a promising candidate for novel targeted therapies in endometriosis treatment.
24622795 PGC-1alpha promoter methylation predicts adiposity and cardiometabolic diseases risk.
24583643 Loss of RIP1 in lung cancer cells suppresses peroxisome proliferator-activated receptor gamma coactivator-1alpha expression.
24561815 Postexercise cooling of the muscles enhances exercise-induced mRNA expression of PGC-1[alpha] and, hence, possibly mitochondrial biogenesis
24554339 Subsequently, we examined in a subset of the study the expression in blood of two genes regulating mitochondrial biogenesis, YY1 and PGC-1alpha. We found a positive association of YY1 expression and mtDNA content in controls.
24529027 These results clearly indicate that non-phosphorylated CRTC2 strongly enhances hepatitis b virus biosynthesis through inducing PGC1alpha expression.
24510228 inherited insulin resistance coincides with reduced mitochondrial oxidative capacity in a PGC-1alpha- and muscle fibre type-related manner
24508229 These data implicate PGC-1alpha signaling as an important regulator of astrocyte reactivity and retinal ganglion cell homeostasis
24503013 HIF-1alpha and HIF-2alpha are involved in hypoxia-induced lipid accumulation in hepatocytes via reducing PGC-1alpha mediated fatty acid beta-oxidation.
24472748 Increasing the number of mitochondria by PGC-1alpha overexpression induces mitochondrial apoptosis.
24463787 Patients after coronary artery bypass graft surgery, who have low PGC-1a levels are at increased risk for new-onset postoperative atrial fibrillation.This selective reduction in PGC-1a was associated with the presence of diabetes mellitus
24457025 Data indicate that a stable cell clones have an intact peroxisome proliferator-activated receptor gamma coactivator 1alpha (PGC-1alpha)/estrogen-related receptor alpha (ERRalpha) axis can be used to detect environmental chemicals that act on the signaling pathway.
24444220 Studied the impact of ACE (I/D), PPARGC1A (G/A) and PPARA (G/C) polymorphisms on footballers performance among 199 Lithuanian professional footballers and 167 sedentary, healthy men (controls).
24430439 Maternal exercise prevented maternal HFD-induced Pgc-1alpha hypermethylation and enhanced Pgc-1alpha and its target gene expression, concurrent with amelioration of age-associated metabolic dysfunction at 9 months of age in the offspring.
24403067 These findings underscore the complexity of PGC-1alpha-mediated mitochondrial homeostasis and establish mitostatin as a key regulator of tumor cell mitophagy and angiostasis.
24402435 Inhibition of PGC-1A suppresses cell proliferation probably by downregulation of VEGF and GLUT-4.
24398293 Data indicate that human PGC-1alpha overexpression promoted amyloid and tau pathology in Tg19959 transgenic mice.
24383721 Evidence found for a role of PPARGC1A in Huntington disease suggests a male-specific effect.
24371810 PGC-1alpha is associated with mitochondrial content, and activity and the ability to cope with energetic stress.
24317794 These findings provide several novel and other confirmatory insights into the role of PPARGC1A variation with respect to diabetes-related metabolic traits
24297698 Using cell lines differentially expressing FXRalpha in overexpression and silencing experiments, we demonstrated that SIRT1 activated the core promoter in an FXRalpha- and PGC-1alpha-dependent manner
24293320 Sphingosine 1-phosphate promotes mitochondrial biogenesis through activating the PGC1A/NRF1/TFAM pathway.
24262291 The study adds to the increasing awareness of PPARGC1A DNA methylation being flexible and influenced by high-fat overfeeding in a birth weight dependent manner with muscle and fat responding differently.
24237962 Data suggest that both PPARGC1A and FNDC5 (fibronectin type III domain-containing protein 5 precursor) mRNA levels in skeletal muscle increase after 12 weeks of exercise training in both control and prediabetes/overweight men.
24204994 Low PGC-1alpha expression is associated with chronic kidney disease after dialysis.
24186207 Data suggest the potential utility of developing metabolic-targeted therapies directed toward the AMP-activated protein kinases (AMPK)-PGC-1alpha protein signaling axis for the treatment of prostate cancer.
23964012 PGC-1alpha expression was also detected in macrophages in human atherosclerosis and was inversely linked to disease progression in patients with the disease.
23954821 PGC-1alpha regulated energy metabolism and anti-apoptosis in Keshan disease.
23951207 These findings suggest that intensity-dependent increases in PGC-1alpha mRNA following submaximal exercise are largely due to increases in muscle recruitment.
23949615 adipose tissue development and function, revealed that Peroxisome proliferator-activated receptor Gamma Coactivator 1-alpha (PGC1-alpha) that regulates the precursor of the hormone Irisin (FNCD5) were abundantly expressed in all three fat depots
23943793 Muscle tissue from patients with ISCU myopathy showed a predominance of type I oxidative muscle fibers and higher capillary density, enhanced expression of transcriptional co-activator PGC-1alpha and increased mitochondrial fatty acid oxidation genes.
23913178 These results demonstrate that GCN5, through its acetyltransferase activity, inhibits PGC1alpha-induced enhancement of hepatitis B virus transcription and replication both in vitro and in vivo.
23836911 a role for Perm1 acting downstream of PGC-1alpha and ERRs to regulate muscle-specific pathways important for energy metabolism and contractile function.
23788330 There are 3 ERRalpha response elements (ERR response element, ERRE) in the osteocalcin promoter, and ERRalpha interacted cooperatively with PGC-1alpha could improve the osteocalcin promoter activity.
23669350 Results show PGC-1alpha as a novel and clinically relevant disease modifier of human and experimental Amyotrophic lateral sclerosis (ALS) with sex-dependent effect.
23648480 findings link NQO1, a cellular redox sensor, to the metabolite-sensing network that tunes PGC-1alpha expression and activity in regulating energy metabolism
23602251 Gly482Ser mutation blunts the effect of PGC-1alpha overexpression on stimulating hepatocyte CPT1a expression.
23505498 increased DNA methylation of the PPARGC1A promoter is unlikely to play a major causal role for the development of insulin resistance in FDR of patients with T2D.
23477830 Melanomas with activation of the BRAF/MAPK pathway have suppressed levels of MITF and PGC1alpha and decreased oxidative metabolism
23438894 These data suggest a critical role for PGC-1alpha in the regulation of hepatic HAMP expression and iron homeostasis under inflammatory circumstances.
23438722 This investigation demonstrates reduced ERRalpha and NRF2 mRNA despite elevations in PGC1A mRNA when recovery post-exercise takes place in a cold environment.
23426382 None of the SNPs in the PPARGC1A gene showed a statistically significant effect either on steady-state concentrations or on the therapeutic response to rosiglitazone
23416000 study has revealed that melanoma tumors present heterogeneous metabolic and energetic states defined by levels of PGC1alpha expression
23354620 Genetic variants of CYP7A1 and its transcriptional activators (HNF4A and PPARGC1A) may activate bile acid synthesis, resulting in the accumulation of bile acids in hepatocytes leading primary biliary cirrhosis progression.
23335958 We have linked the co-activator of a lipid-sensing transcription factor (PPARG co-activator 1 alpha, PPARGC1A) to age-related macular degeneration (AMD) and AMD-associated genes.
23312803 Upregulation of PPARGC1 in an Alzheimer's transgenic mouse model restores cognition following nicotinamide riboside administration.
23285255 Muscle PGC1-alpha mRNA expression was attenuated as it increased by 11- and 4- fold (P<0.001) after exercise pre- and post-training, respectively.
23277535 Biogenesis and remodelling of mitochondria elicited by PGC1alpha contribute to an increase in oxidative metabolism and the preservation of reactive oxygen species homeostasis
23269818 genetic association studies in a population of children in Taiwan: Data suggest that an SNP in PPARGC1A (rs8192678) is associated with nonalcoholic fatty liver disease in obese Taiwanese children.
23217713 Expression of PGC-1alpha4 is preferentially induced in mouse and human muscle during resistance exercise; these studies identify a PGC-1alpha protein that regulates and coordinates factors involved in skeletal muscle hypertrophy.
23201126 Inhibition of PGC-1a and PGC-1b blocks the alpha-MSH-mediated induction of MITF and melanogenic genes.
23178651 These data highlight the role of PGC1alpha-mediated mitochondrial biogenesis in neuroblatoma cells and suggest PGC1alpha as a potential target for enhancing the effectiveness of therapy in aggressive drug resistant neuroblastoma.
23175776 a key role for the exercise-responsive transcriptional coactivator PGC-1alpha in coordinating intramuscular lipid droplet programming
23150719 FLCN deficiency and subsequent increased PPARGC1A expression result in increased mitochondrial function and oxidative metabolism as the source of cellular energy, which may drive hyperplastic transformation.
23086295 Combined whole-body vibration, resistance exercise, and sustained vascular occlusion increased skeletal muscle PGC-1alpha transcripts.
23073717 reduced neuronal PGC-1alpha expression in multiple sclerosis cortex partly underlies mitochondrial dysfunction in multiple sclerosis grey matter
23050972 overview of role of PPARGC1A in skeletal muscle: PPARGC1A appears to regulate mitochondrial biogenesis and expression of oxidoreductases. PPARGC1A appears to play protective role against atrophy-linked skeletal muscle deterioration. [REVIEW]
22974658 TRbeta1 binds PGC-1alpha in a second ligand and LxxLL motif independent mode and show this interaction requires the TRbeta1 N-terminal domain and the PGC-1alpha N-terminal activation domain at amino acids 1-130.
22939990 Absence of PGC-1 proteins accelerated the transition to heart failure following pressure overload.
22861165 TP53 binds to the PPARGC1A promoter and this event is positively related to increased PGC-1alpha expression.
22825315 results do not support rs7665116 as a modifier of age of onset of motor symptoms of Huntington's disease
22732512 Our results suggest that PGC-1a induction, which leads to elevated expression of gluconeogenetic genes and increased glucose production in hepatitis c virus (HCV)-infected cells, is a central mechanism of insulin resistance associated with HCV infection.
22684233 In European subjects with type 2 diabetes mellitus the GA relative to the GG genotype is associated with a 70% increase in the risk of micro/microalbuminuria.
22652814 findings suggest that PPARGC1A variations may influence PPARGC1A expression and the coordinating regulators of downstream targets in energy homeostasis
22589246 extended PPARGC1A genomic locus encodes several new brain-specific isoforms and influences Huntington disease age of onset.(3461-73)
22589185 Show that a genetic defect of complex-I of the OXPHOS system may associate with transcriptional derangements of mitochondrial biogenesis through stabilization of the master transcriptional regulator PGC-1alpha.
22392034 With the factors of sex, age, major depressive disorder, and Apoepsilon4 controlled, PGC-1alpha still increased the risk for insomnia
22340220 Reduced PGC-1alpha expression by PA in betaTC3 cells could involve the activation of canonical NF-kappaB pathway, so as to deteriorate the PA induced apoptosis.
22333269 Suggest that lower expression of HNF4alpha and PGC1alpha may impair rifampicin-mediated CYP3A4 induction under conditions of PXR overexpression in fetal liver cells.
22310107 Gene variants in PPARD and PPARGC1A might be associated with timing of natural menopause, probably through direct actions on the ovaries, among the general Japanese population.
22285815 the role of PGC-1alpha in cellular metabolism in cancer. [Review]
22267390 PGC-1alpha mRNA increased 3 h postexercise in human skeletal muscle
22266114 The findings uncovered an unexpected link between PGC-1a-mediated nutrient availability, unfolded protein response, and ErbB2/Neu levels.
22247001 relationships between polymorphisms of the ACE, ACTN3, PPARD, and PPARGC1A genes and performance as measured by six fitness tests in sedentary adolescent girls
22212273 PPARGC1A gene expression depends on exercise intensity in human skeletal muscle.
22194199 PGC-1alpha Gly482Ser polymorphism is associated with hypertension in Mongolians in Inner Mongolia.
22122487 The results suggested that the PPARGC1A Gly482Ser polymorphism is associated with elite endurance athletic status. These findings support the hypothesis that the PPARGC1A 482Ser allele may impair aerobic capacity.
22113536 the induction of PGC-1alpha gene expression after exercise is enhanced when acutely exposed to a cold environment.
22106445 A single nucleotide polymorphism in PPARGC1A interacted with alcohol consumption in African Americans, and a different single nucleotide polymorphism in PPARGC1A was nominally associated in Caucasians.
22102466 The onset of amyotrophic lateral sclerosis is not altered, but progression of the disease is significantly slower in PGC-1alpha/Gly93Ala transgenic mice.
22087236 induction of PGC-1alpha expression can be part of the recovery response to an STEMI and could serve as a prognosis factor of cardiac recovery.
22052997 casein kinase 1-delta phosphorylation of PGC-1alpha within its arginine/serine-rich domain enhances its degradation through the proteasome system
22049338 Disorder-to-order transition underlies the structural basis for the assembly of a transcriptionally active PGC-1alpha/ERRgamma complex
22016516 This study demonstrated that PGC-1alpha is both necessary and sufficient for the production of oxytocin, implicating hypothalamic PGC-1alpha in the direct activation of a hypothalamic hormone known to control energy intake.
21994947 the curcumin/LKB1/AMPK/SMILE/PGC1alpha pathway differentially regulates ER stress-mediated gene transcription
21918181 Transgenic PGC-1alphaplays a novel role in altering the contractile properties of skeletal muscle by modulating calcium handling.
21914785 In human tumor xenograft mice, gain and loss of PGC1alpha expression showed that PGC1alpha also promotes tumor growth and affects lipid-metabolism gene expression.
21894159 the Gly482Ser polymorphism may predict a more favorable metabolic and inflammatory outcome for obese patients submitted to bariatric surgery, leading to a reduced atherosclerotic risk.
21883960 mRNA of PGC-1alpha and PDK4 increases markedly in both type I and type II skeletal muscle after either continuous or interval exercise
21880746 Protein kinase B is shown to modulate PGC1alpha activity and, hence, hepatitis B virus transcription and replication in a cell line-specific manner.
21862870 PGC1alpha-induced oxidative burst represents one of the main apoptosis-driving factors in colorectal cancer cells.
21862727 Exercise can activate an upstream promoter in humans and support AMPK as a major regulator of transcripts from the canonical PGC-1alpha promoter and the involvement of beta-adrenergic stimulation in combination with AMPK in the regulation of PGC-1alpha-b.
21784897 IHG-1 increases mitochondrial biogenesis by promoting PGC-1alpha-dependent processes, potentially contributing to the pathogenesis of renal fibrosis
21757867 Our data suggest that N-truncated PGC1alpha is an important component of the PGC1alpha transcriptional network
21733854 decreased PGC-1alpha protein level was abolished by MG132, a potent proteasome inhibitor, suggesting that PGC-1alpha is degraded through the ubiquitin-proteasome pathway upon UV-irradiation
21687738 Expression of PGC-1alpha and mtTFA was increased in fibroblasts from Friedreich ataxia fibroblasts
21595954 These data reveal associations of the PGC-1alpha SNPs rs6821591 and rs2970848 with risk or age of onset of Parkinson's disease, and of the PGC-1a rs8192678 GG and the rs6821591 CC variants with longevity.
21486805 Suggest a novel role of STARS in the co-ordination of PGC-1alpha-induced upregulation of the fat oxidative gene, CPT-1beta.
21467224 PGC1alpha regulates enterocyte cell fate and protects against tumorigenesis.
21451146 An acute bout of low-volume, high-intensity interval training activates mitochondrial biogenesis through a mechanism involving increased nuclear abundance of PGC-1alpha.
21447778 Single nucleotide polymorphism in PPARGC1A gene is associated with epithelial ovarian cancer.
21358044 Alzheimer's disease patients show a reduction in brain cortex level of PGC-1alpha.
21294239 Gly482Ser and Thr394Thr polymorphisms of PPARGC1A gene were significantly associated with type 2 diabetes mellitus.
21244673 The Gly482Ser variant in PPARGC1A is associated with body mass index in Tongans but not in Maori. In a sample of 58 populations worldwide, we also show that the 482Ser risk allele reaches its highest frequency in the Pacific.
21215313 data confirm the role of parkin in mitochondrial homeostasis and suggest a potential involvement of the PGC-1alpha pathway in the pathogenesis of Parkinson's disease
21187426 Pim-3 has an important role in modulating c-Myc and PGC-1alpha protein levels and cell growth
20952631 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20944660 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20931535 Polymorphism of PPARGC1A is associated with type 2 diabetes mellitus and insulin resistance.
20931535 Observational study of gene-disease association. (HuGE Navigator)
20890895 Our data suggest that the IR phenotype and the liver transcriptional activity of PPARGC1A show a tight interaction, probably through epigenetic modifications.
20884884 The PPAR-gamma coactivator (PGC)-1 family of proteins plays a central role in cardiac intermediary metabolism and cardiac energetics
20851810 Baicalin stimulates angiogenesis by inducing VEGF expression through the activation of the ERRalpha/PGC-1alpha pathway.
20816721 The expression of PGC-1alpha is repressed by estrogens in the mouse specifically in the uterus.
20733583 Observational study of gene-disease association. (HuGE Navigator)
20732852 The activation of the PPARgamma/PGC-1alpha pathway may protect against COPD progression by upregulating gamma-GCS and relieving oxidative stress.
20716531 PGC-1alpha coordinates lipogenesis, intramyocellular lipid accumulation, and substrate oxidation in exercised skeletal muscle in vivo.
20713359 Ubiquitin proteasome-dependent degradation of the transcriptional coactivator PGC-1{alpha} via the N-terminal pathway.
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20679960 Observational study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20670916 The level of PGC-1alpha determines whether the cAMP/PKA-pathway overall stimulates or inhibits HNF-4alpha transcriptional activation.
20661474 Results indicate that Sirt3 functions as a downstream target gene of PGC-1alpha and mediates the PGC-1alpha effects on cellular ROS production and mitochondrial biogenesis.
20647061 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20638986 PPARalpha and PGC-1alpha stimulate transcription of the CPT-1A gene through different regions of CPT-1A gene.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20551328 PGC-1alpha plays an important role in partitioning cytoplasmic TG toward the VLDL secretory compartments and promoting VLDL secretion via transcriptional induction of CideB.
20531298 We review here how these metabolic signaling pathways, affecting GCN5 and Sirt1 activity, allow the reversible acetylation-deacetylation of PGC-1alpha and the adaptation of mitochondrial energy homeostasis to energy levels.
20512451 PPARGC1A gene variants were not associated with coronary artery disease and metabolic risk factors of coronary atherosclerosis in a Russian population.
20512451 Observational study of gene-disease association. (HuGE Navigator)
20498286 These data suggest that the PGC-1alpha Thr394Thr and Gly482Ser polymorphisms are associated with therapeutic efficacy of multiple-dose rosiglitazone in Chinese patients with type 2 diabetes mellitus.
20498286 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20492333 Observational study of gene-disease association. (HuGE Navigator)
20477822 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20448046 Peroxisome proliferator-activated receptor gamma co-activator 1alpha (PGC-1alpha) and sirtuin 1 (SIRT1) reside in mitochondria and may have a direct function in mitochondrial biogenesis
20437825 Observational study of gene-disease association. (HuGE Navigator)
20426853 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20401754 Review: PGC-1alpha-mediated regulation of metabolically related, anti-oxidant and inflammatory proteins in skeletal muscle in the basal state and in response to exercise training.
20384434 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20383327 PGC-1alpha down-regulation is likely to contribute to the blunted antioxidant response observed in cells from Friedreich's ataxia patients.
20371735 the p38gamma MAPK-PGC-1alpha regulatory axis is critical for exercise-induced metabolic adaptations in skeletal muscle--REVIEW
20368732 Hypoxia induces expression of PGC-1alpha and mitochondrial biogenesis in cultured cardiac myocytes through the AMP-activated protein kinase (AMPK) signaling pathway.
20308248 exercise intensity regulates PGC-1alpha mRNA abundance in human skeletal muscle in response to a single bout of exercise
20211864 Propose that p65 directly represses PGC-1alpha activity in cardiac cells, thereby leading to a reduction in pyruvate dehydrogenase kinase 4 (PDK4) expression and the subsequent increase in glucose oxidation observed during the proinflammatory state.
20200320 Increasing PGC-1alpha protein levels in obesity does not correct the obesity-related absolute reduction in fatty acid oxidation or mitochondrial dna content, implicating mechanisms other than PGC-1alpha abundance.
20178833 Knockdown of PPARGC1A increases the propensity to accumulate alpha-Syn oligomers, but the accumulation appears to have very little toxic impact to the neuronal cells
20139785 The relative intensity of brief intermittent exercise is of major importance for the exercise-induced increase of several mRNA, including that of PGC-1alpha
20133449 Results indicate that PGC-1 is involved in progesterone production in ovarian granulosa cells by potentiating transcriptional activities of the NR5A family proteins.
20130411 in polycystic ovary patients, the PPAR-gammaPro12Ala and the PGC-1alpha Gly482Ser polymorphism may modulate the concentrations of serum HDL levels and postprandial 2-hour insulin level, respectively
20125101 The association between glucose and PPARGC1A was only present in lean subjects suggesting that the effect of the PPARGC1A gene, which is involved both in fatty acid oxidation and glucose metabolism, is modified by body mass index
20106991 In human skeletal muscle, activation of cytosolic p38 MAPK and AMPK may be potential signals that lead to increased nuclear abundance and activation of PGC-1alpha in response to an acute bout of endurance exercise.
20067526 We therefore hypothesize that the ERRalpha-PRC complex plays a role in arresting the cell cycle through the regulation of oxidative phosphorylation in oxidative cells, and through some other pathway in glycolytic cells.
20045142 PGC-1 Gly482Ser polymorphism is not associated with the therapeutic response of pioglitazone in Chinese diabetic patients.
20045142 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20044476 Observational study of gene-disease association. (HuGE Navigator)
20032281 Patients with early-onset type 2 diabetes display abnormalities in the exercise-dependent pathway that regulates the expression of PGC-1alpha and Mfn2.
19965780 PGC-1alpha regulates reactive oxygen species generation and apoptosis in endothelial cells by increasing fatty acid oxidation and enhancing ATP/ADP translocase activity.
19961051 The Gly482Ser polymorphism of PGC-1 was not associated with insulin resistance or type II diabetes mellitus but diabetic subjects with the AA genotype had higher triglycerides.
19961051 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913841 In overweight, nondiabetic Chinese adults, G482S polymorphism in the PPARGC1A gene is associated with hyperinsulinemia, HOMA-IR indices, and abdominal obesity.
19913841 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19903700 important relationship between PPARdelta, PGC1alpha, and haem oxygenase-1, demonstrating that haem oxygenase-1 induction plays an important role in cytoprotective actions of PPARdelta ligands in vascular endothelium
19900151 The Gly482Ser polymorphism of the PPARGC1A gene is associated with diabetic nephropathy in Asian Indians.
19900151 Observational study of gene-disease association. (HuGE Navigator)
19884383 Data indicate PPARGC1A is involved in the proliferation of AR-expressing prostatic cancer cells by acting as an coactivator of the androgen receptor (AR). PPARGC1a interacts with N-terminal domain of AR to enhance DNA-binding of AR.
19876004 Observational study of gene-disease association. (HuGE Navigator)
19861117 This study demonstrates, for the first time, that the increased mitochondrial biogenesis in type I endometrial cancer is associated to the upregulation of PGC-1alpha signalling pathway.
19846556 Results describe the crystal structure of HNF4alpha in complex with a fragment of PGC-1alpha containing all three of its LXXLL motifs.
19828207 Observational study of gene-disease association. (HuGE Navigator)
19793822 The effects of PGC1alpha and SHP on hepatitis B viral biosynthesis in the human hepatoma cell line Huh7 were similar to those observed in the nonhepatoma cells expressing ERRalpha and ERRgamma.
19793803 PGC1alpha and SHP modulated hepatitis B viral biosynthesis differently in the human hepatoma cell lines HepG2 and Huh7, indicating distinct modes of transcriptional regulation.
19723495 Methylation levels were negatively correlated with PGC-1alpha mRNA and mitochondrial DNA.
19681917 Meta-analysis of gene-disease association and gene-gene interaction. (HuGE Navigator)
19680556 Observational study of gene-disease association. (HuGE Navigator)
19666693 a higher frequency of the PPARGC1A + peroxisome proliferator-activated receptor delta genotype is associated with elite-level endurance athletes
19666693 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19653005 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19625249 reversible SUMOylation can adjust the activity of PGC-1alpha add a novel layer to the regulation of the coactivator.
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19567523 PRDM16 and PGC-1 alpha expression was 2-fold greater in epicardial than sc fat.
19536736 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19460884 Expression of PGC-1alpha was significantly reduced in myoblasts from Huntington's disease patients.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19451226 Transcriptional profiling demonstrated that Bcl3 activates genes involved in diverse pathways including a subset involved in cellular energy metabolism known to be regulated by PGC-1alpha, ERRalpha, and a second nuclear receptor, PPARalpha.
19446346 This review focuses on the recent identification of physiological and pathophysiological contexts involving PGC-1alpha and the therapeutic importance of PGC-1alpha-controlled cellular and systemic metabolism are outlined.
19435887 PGC-1alpha-induced fatty acid oxidation and mitochondrial biogenesis appear to be independent of PPARdelta
19422653 Data indicate that a lower frequency of the PPARGC1A Ser482 allele is associated with top-level endurance athletes.
19422653 Observational study of gene-disease association. (HuGE Navigator)
19422651 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19420105 Observational study of gene-disease association. (HuGE Navigator)
19389810 DHEA production is regulated by PGC-1alpha, ERRalpha, and HNF4alpha
19371772 Studies ahow that PGC-1alpha is uniquely poised as a potential target for correcting the effects of age on mitochondrial decline.
19322023 Overexpression of peroxisome proliferator activated receptor gamma coactivator-1alpha in HepG2 cells represses the gene expression of LDL receptor and does not affect the estrogen receptor alpha -induced LDL receptor expression.
19297390 PGC-1alpha and PGC-1beta expression improved mitochondrial respiration in cells from patients with mitochondrial disorders.
19273754 Preservation of neuronal PGC-1alpha expression promotes the nonamyloidogenic processing of amyloid precursor protein precluding the generation of amyloidogenic Abeta peptides.
19265027 Polymorphisms in PPARGC1A assessed in relatives of humans with type 2 diabetes.
19265027 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19237423 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19233136 These results reveal a potential molecular basis for isoform-specific regulation of PGC-1alpha expression in contracting muscle.
19200361 Observational study of gene-disease association. (HuGE Navigator)
19183932 Variation at PPARGC1A is unlikely to have a major impact on cardiovascular or metabolic health in a study of children.
19183932 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19179292 PGC-1alpha is coupled to HIF-1alpha-dependent gene expression by increasing mitochondrial oxygen consumption in skeletal muscle cells
19148128 Potential role of promoter PPARGC1A promoter in newborn birth weight involving maternal pregestational body mass index.
19148128 Observational study of gene-disease association. (HuGE Navigator)
19142226 PGC-1alpha-mediated inhibition of vascular smooth muscle cells proliferation
19118529 These results suggest that PGC-1alpha regulates multiple pathways in neurons and that HDACi's may be good candidates to target PGC-1alpha and GLUT4 in Huntington's Disease and other neurological disorders.
19112161 Brief intense interval exercise activates AMPK and p38 MAPK signaling and increases the expression of PGC-1alpha in human skeletal muscle.
19103600 novel post-translational modifications of PGC-1alpha, including O-GlcNAc, and describe a novel mechanism for how PGC-1alpha co-activates transcription by FoxO1.
19102936 PGC-1alpha is down-regulated in liver cancers and is involved in the malignant transformation in human normal liver cells in vitro.
19077249 The Ser allele of the PPARGC1A Gly48Ser polymorphism is associated with decreased risk of diastolic left ventricular dysfunction in men, but not in women.
19077249 Observational study of gene-disease association. (HuGE Navigator)
19070258 the presence of the Ala allele at the PPARG/Pro12Ala polymorphism and the Ser allele at the PPARGC1A/Gly482Ser polymorphism may be a predisposing factor for sarcoidosis.
19070258 Observational study of gene-disease association. (HuGE Navigator)
19065516 Observational study of gene-disease association. (HuGE Navigator)
19061896 Results implicate PGC-1alpha and ERRalpha in the pathophysiology of human heart failure.
19056482 Observational study of gene-disease association. (HuGE Navigator)
19038972 TNF-alpha reduces PGC-1alpha expression through NF-kappaB and p38 MAPK leading to increased glucose oxidation in a human cardiac cell model.
18996470 An assay using unlabeled probes and the LightCycler or Rotor-Gene instruments was developed for genotyping of PPARG, PPARGC1A and transcription factor 7-like 2 (TCF7L2) polymorphisms.
18996470 Observational study of genetic testing. (HuGE Navigator)
18974883 A novel AMPK-mediated regulatory pathway that regulates PGC-1alpha gene expression.
18950845 Observational study of gene-disease association. (HuGE Navigator)
18923559 The present review examines the evidence in support of the key role for PGC-1alpha regulation of substrate metabolism and mitochondrial biogenesis in skeletal muscle--REVIEW
18823672 These data show an increased risk of insulin resistance in obese carrying the rs8192673 Ser482Ser genotype.
18823672 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18801770 Observational study of gene-disease association. (HuGE Navigator)
18786524 PPAR-alpha and PGC-1A polymorphisms are associated with alcohol consumption in the Mediterranean population
18786524 Observational study of gene-disease association. (HuGE Navigator)
18719883 No differences in mRNA levels of genes which mediate the transcriptional of mitochondrial biogenesis (PPARGC1A and NRF1) or in mitochondrial mass between diabetic and control myotubes.
18689799 DJ-1 stimulates the activity of a master regulator of mitochondrial biogenesis and stress response, peroxisome proliferator-activated receptor-gamma co-activator 1alpha (PGC-1alpha), in the transcription of the MnSOD
18673300 Results describe the mapping of the nucleosome positions of the estrogen-related receptor alpha gene promoter and examine the changes of histone acetylation in response to peroxisome proliferator-activated receptor-gamma coactivator-1alpha expression.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18653753 Examine rapid exercise-induced changes in PGC-1alpha mRNA and protein in human skeletal muscle.
18614852 The observed gender-specific association between PGC-1alpha and the plasma adiponectin level may reflect linkage disequilibrium of Gly482Ser polymorphism with other causative variations.
18614852 Observational study of gene-disease association. (HuGE Navigator)
18588668 PPARGC1A polymorphism and lower expression of PPARGC1A mRNA in the liver are an important genetic contribution to etiology of nonalcoholic fatty liver disease.
18588668 Observational study of gene-disease association. (HuGE Navigator)
18565194 The PPARGC1A glycine482serine polymorphism may contribute to the risk of coronary artery disease in a Chinese population.
18565194 Observational study of gene-disease association. (HuGE Navigator)
18563384 May be important in the human glucose-6-phosphatase catalytic subunit gene promoters activation.
18501443 PPARGC1A up-regulates APLN protein in human adipocytes.
18469005 the strong interaction of PGC-1alpha and PPARgamma is mediated through both hydrophobic and specific polar interactions.
18467552 Meta-analysis suggests that the PPARGC1A Ser482 allele may be associated with higher blood pressure, but this is only apparent in younger adults.
18467552 Meta-analysis of gene-disease association. (HuGE Navigator)
18451773 Observational study of gene-disease association. (HuGE Navigator)
18441008 providing a plausible explanation for distinct PGC-1alpha binding to ERRalpha monomers and homodimers
18438697 Observational study of gene-disease association. (HuGE Navigator)
18385139 PGC-1alpha is an important co-activator for LRH-1 and that SHP targets the interaction between LRH-1 and PGC-1alpha to inhibit CYP7A1 expression.
18370824 Observational study of gene-disease association. (HuGE Navigator)
18331997 Data show that PPARGC1A is a susceptibility gene for type 2 diabetes in Chinese Han population in Hubei.
18331997 Observational study of gene-disease association. (HuGE Navigator)
18270681 After downregulation of PPARGC1A expression in human islets by small interfering RNA, insulin secretion was reduced by 41%.
18270681 Observational study of gene-disease association. (HuGE Navigator)
18242180 Increased histone acetylation might be responsible for PGC-1alpha-mediated transactivation of a minimal E-cadherin promoter.
18162502 PPARGC1A variations influence development of type 2 diabetes and cardiovascular diseases via DNA damage.
18162502 Observational study of gene-disease association. (HuGE Navigator)
18067759 The results suggested that the 482Ser variant of PGC-1alpha conferred the susceptibility to type 2 diabetes in the southern Chinese population.
18067759 Observational study of gene-disease association. (HuGE Navigator)
17999673 Observational study of gene-disease association. (HuGE Navigator)
17971240 G482S and +2962A/G polymorphisms of PGC-1alpha gene were significantly associated with only severe hypertension in 1642 apparently healthy Chinese residents.
17971240 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17971240 Polymorphisms of PGC-1alpha gene were only significantly associated with severe hypertension defined by occasional clinic blood pressure measurements.
17926914 Observational study of gene-disease association. (HuGE Navigator)
17907962 Improvement and restoration of mitochondrial function and oxidative capacity through activation of PGC-1 alpha could provide new treatments for metabolic diseases, as suggested by the evidence in this review.
17828388 Weight loss upregulates PGC1A, which in turn stimulates mitofusin-2 expression, which contributes to the improvement of insulin sensitivity.
17701054 comparison of risk genotype combinations of: UCP2-866GG, mtDNA 10398A and PGC1alpha p.Thr394Thr or p.Gly482Ser for NIDDM
17701054 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17680531 The 482G/A variant could decrease binding force between PGC-1alpha and MEF2C and increase the risk of type 2 diabetes in Chinese Han population by PGC-1alpha -MEF2C-GLUT-4 pathway.
17680531 Observational study of gene-disease association. (HuGE Navigator)
17646210 Novel pathways regulated by PGC-1 alpha reveal that PPARalpha controls gene expression in human white adipocytes.
17630210 Observational study of gene-disease association. (HuGE Navigator)
17579564 Observational study of gene-disease association. (HuGE Navigator)
17579564 No association was found between PGC-1alpha polymorphism and hypertension with or without LVH; data indicate that variants of the PGC-1alpha gene are correlated with increased risk for HCM.
17502589 Review. PGC-1a is a master regulator of myocardial energy metabolism in diverse physiological and pathophysiological conditions.
17490458 results do not support previous data on Caucasians showing an association between the Gly482Ser variant in PPARGC1A and VO2max but suggest the potential role of another polymorphism (A2962G) to explain individual VO2max differences in Chinese men.
17490458 Observational study of gene-disease association. (HuGE Navigator)
17479445 Observational study of gene-disease association. (HuGE Navigator)
17479445 No association between this gene and type 2 diabetes or body mass index in a Hispanic and non-Hispanc population in Colorado.
17457313 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17418099 Our results indicate an essential role for ERRalpha as a key regulator of oxidative metabolism.
17390150 Observational study of gene-disease association. (HuGE Navigator)
17390150 Mitochondrial genotype observed in association with Type 2 Diabetes Mellitus in combination with PGC1A variants showed an increased prevalence in controls with mt10398G and 16189T along with G/G genotype background at the two polymorphic loci of PGC1A.
17374560 Expression of peroxisome proliferator-activated receptor gamma coactivator 1alpha (PGC-1alpha), known to be upregulated in the liver by fasting, was found to abolish the cAMP-dependent downregulation of glucagon receptor mRNA expression in vitro.
17372612 PGC-1alpha was involved in the apoptotic signal transduction pathways and downregulation of PGC-1alpha may be a key point in promoting epithelial ovarian cancer growth and progression.
17355643 Observational study of genotype prevalence. (HuGE Navigator)
17342473 Observational study of gene-disease association. (HuGE Navigator)
17327880 Observational study of genotype prevalence. (HuGE Navigator)
17327880 We therefore suggest that this PPARGC1A allele may play a role in the large difference in type II diabetes prevalence between Polynesians and neighboring populations.
17327385 Observational study of gene-disease association. (HuGE Navigator)
17327385 the minor G allele of PPARD was associated with less increase in individual anaerobic threshold during lifestyle intervention
17322100 The activated proinflammatory state of monocytes and MDM in low HDL-C subjects constitutes a novel parameter of risk associated with HDL deficiency, related to altered expression of metallothionein genes and the reciprocal regulation of PPARgamma.
17290397 PPAR gamma mRNA was significantly higher in normal colon tissue compared with tumor tissue.
17284167 deletion of the activation domains (AD) did not eliminate ability of PGC-1alpha to interact with thyroid hormone receptor. data indicate that AD1 & AD2 motifs mediate induction of many PGC-1- responsive genes.
17241533 Thr394Thr SNP in the PPARGC1 gene was associated with peak BMD in the femoral neck in Chinese women.
17241533 Observational study of gene-disease association. (HuGE Navigator)
17216277 Non-esterified fatty acid clearance is blunted following a glucose load in carriers of the PPARCG1A Ser482 allele, and is associated with obesity.
17187763 This is the first study implicating that the Gly482Ser and Thr612Met polymorphisms in PGC-1alpha and Pro12Ala polymorphism in PPARgamma2 do not affect the functional integrity of these proteins.
17150186 These findings suggest that PGC-1alpha elevates the binding of GR to Palin and thereby enhances the GR-mediated inhibition of human insulin transcription.
17108241 Its regulatory function in lipid metabolism makes it an inviting target for pharmacological intervention in the treatment of obesity and Type 2 diabetes. (Review)
17032743 PGC-1alpha is involved in the RNA processing of TRalpha transcripts.
17018837 Recent studies have elucidated the function of the PGC-1 coactivators in different tissues and have highlighted the implications of PGC-1 dysregulation in diseases such as diabetes, obesity, cardiomyopathy, or neurodegeneration.
17018277 Data show that mutant huntingtin causes disruption of mitochondrial function by inhibiting expression of PGC-1alpha.
16978381 Observational study of gene-disease association. (HuGE Navigator)
16978372 Observational study of gene-disease association. (HuGE Navigator)
16929032 the induction of apoA-IV expression in fasting and diabetes likely involves PGC-1 alpha-mediated coactivation of HNF-4 alpha in addition to glucocorticoid-dependent actions
16902166 Observational study of gene-disease association. (HuGE Navigator)
16902166 Risk factors for distinct carotid phenotypes may vary and suggest, but do not prove, that PGC-1alpha may contribute to the regulation of atherogenic pathways.
16896940 Acute elevation of plasma non-esterified fatty acd levels downregulates PPARGC1A, PPARGC1B and PPARA expression.
16891621 Nitric oxide can regulate the mitochondrial reactive oxygen species detoxification system both positively and negatively through PGC-1alpha.
16891307 A key coactivator for the proper function of HNF4alpha in human liver and for an integrative control of multiple hepatic genes involved in metabolism and homeostasis.
16882880 These results establish the importance of coactivators PGC1alpha and SRC1 for the hepatic expression of human P450s and uncover a new HNF4alpha-dependent regulatory mechanism to constitutively control the CYP1A1/2 cluster.
16857725 CYP2A6 is induced via PXR and PGC-1alpha through the DR4-like element at the distal response region.
16804087 Observational study of gene-disease association. (HuGE Navigator)
16804087 Single nucleotide polymorphisms in PPARD modify the conversion from glucose intolerance to type 2 diabetes particularly in combination with polymorphisms in PGC-1A.
16753578 The PGC-1alpha protein is directly acetylated by GCN5 resulting in a transcriptionally inactive protein that relocalizes from promoter regions to nuclear foci.
16752166 Defects in PGC-1alpha expression and regulation may contribute to the pathophysiology of type 2 diabetes in humans.
16704985 Observational study of gene-disease association. (HuGE Navigator)
16704985 PPARGC1A, PPARGC1B, and EP300 may have roles for familial breast cancer susceptibility
16631115 These results suggest that PGC-1alpha variants with Gly/Gly at 482nd amino acid may impair the Tfam transcription, a regulatory function of mitochondrial biogenesis, resulting in dysfunctional mtDNA replication.
16600233 Observational study of gene-disease association. (HuGE Navigator)
16600233 The polymorphisms of the peroxisome proliferator-activated receptor-gamma (Pro12Ala) and its coactivator-1 (Gly482Ser) genes were investigated among 201 Chinese Han women with polycystic ovary syndrome (PCOS).
16494845 The results obtained using truncated PGC-1alpha proteins suggested that two regions are necessary for PGC-1alpha to interact with the DNA-binding complex of RXRalpha/FXR.
16474966 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16474966 The risk of obesity associated with 482Ser is evident only in physically inactive elderly male subjects
16446747 Observational study of gene-disease association. (HuGE Navigator)
16443502 Observational study of gene-disease association. (HuGE Navigator)
16435105 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
16435105 Meta-analysis: a modest role for the Gly482Ser PPARGC1A variant in type 2 diabetes risk
16403952 Significant association found between the Gly482Ser missense mutation of the PGC-1alpha gene and reduced insulin sensitivity in obese subjects indicates a primary role for PGC-1alpha in genetic susceptibility to insulin resistance.
16395669 Observational study of gene-disease association. (HuGE Navigator)
16341842 Expression in differentiated human skeletal muscle cells is induced by unsaturated non-esterifed fatty acids.
16241916 Observational study of gene-disease association. (HuGE Navigator)
16216916 Observational study of gene-disease association. (HuGE Navigator)
16216916 Data suggest that the Gly482 Ser variant of the peroxisome proliferator-activated receptor gamma coactivator-1alpha gene may be an independent genetic risk factor for young-onset hypertension.
16150865 A single nucleotide in an ERRalpha binding site can determine specific configuration to the receptor and productive interaction with the coactivator PGC-1alpha.
16132959 fatty acids differentially regulated expression of the genes encoding the PGC-1A isoform
16123152 The peroxisome proliferator-activated receptor-gamma coactivator-1alpha enhanced the GR/dexamethasone activation of the hNTCP promoter.
16122961 Observational study of gene-disease association. (HuGE Navigator)
16086291 The study suggested that the PGC-1alpha gene might be implicated in the pathogenesis of T2DM. But the studied SNPs in PGC-1alpha gene may not be major susceptibility ones of T2DM mellitus in Han people of Shanghai.
16086291 Observational study of gene-disease association. (HuGE Navigator)
16051671 Coactivator peroxisome proliferator-activated receptor-gamma coactivator-1alpha is capable of stimulating the HNF-4alpha-dependent transactivation of apoAV promoter.
15964996 PGC-1alpha coactivator activity is potentiated by arginine methylation by protein arginine methyltransferase 1 (PRMT1), another nuclear receptor coactivator.
15937669 Observational study of gene-disease association. (HuGE Navigator)
15937669 PPARGC1A promoter polymorphisms are associated with age at diagnosis of type 2 diabetes and early-onset type 2 diabetes in the Korean population.
15912394 Observational study of gene-disease association. (HuGE Navigator)
15912394 PPARGC1A is likely to contribute to the risk of diabetes in offspring of patients with type 2 diabetes.
15908514 PGC-1 alpha serves as a coactivator for the vitamin D receptor.
15864539 Enhanced insulin-stimulated glycogen synthesis in human skeletal muscle cell culture coincides with increased PGC1 mRNA expression following treatment with various antidiabetic agents.
15824463 Observational study of gene-disease association. (HuGE Navigator)
15824463 two variations in the PGC-1alpha gene might not contribute to the risk of hypertension and type 2 diabetes in the Chinese population studied here
15821111 Data demonstrate that the multi-hormone response element of the estrogen-related receptor-alpha (ERRalpha) gene is a target for ERRgamma transactivation, which is enhanced by peroxisome proliferator-activated receptor-gamma coactivator-1alpha.
15782399 Observational study of gene-disease association. (HuGE Navigator)
15738346 Observational study of gene-disease association. (HuGE Navigator)
15738346 Ser allele of PGC-1alpha Gly482Ser confers a significantly reduced risk of hypertension in whites.
15705733 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15705733 summary, our data indicate a role for the Gly482Ser genotype in determining aerobic fitness.
15649578 Observational study of gene-disease association. (HuGE Navigator)
15599700 Observational study of gene-disease association. (HuGE Navigator)
15599700 sex-specific association between Gly482Ser polymorphism and arterial hypertension in type 2 diabetic men.
15592662 Observational study of gene-disease association. (HuGE Navigator)
15592662 482Ser allele of the PGC-1alpha gene is associated with the conversion from impaired glucose tolerance to type 2 diabetes in the STOP-NIDDM trial.
15582274 Observational study of gene-disease association. (HuGE Navigator)
15581067 Observational study of gene-disease association. (HuGE Navigator)
15581067 Gly482Ser polymorphism of the PGC-1 gene should be considered as a risk factor for the development of type 2 diabetes in Caucasians.
15337744 study of the crystal structure of ERRalpha ligand binding domain in complex with peroxisome proliferator-activated receptor coactivator-1alpha
15329387 PGC-1alpha functions as a potent coactivator for FXR and further implicates its role in the regulation of genes that are involved in bile acid and lipid metabolism.
15322103 ligand-activated PXR interferes with HNF-4 signaling by targeting the common coactivator PGC-1, which underlies physiologically relevant inhibitory cross-talk between drug metabolism and cholesterol/glucose metabolism
15254719 both PPARgamma and its coactivator PGC-1 play important roles in the development and progression of breast cancer
15146371 Observational study of gene-disease association. (HuGE Navigator)
15146371 Gly482Ser variant in PGC-1 is not associated with diabetes-related traits or skeletal muscle fiber type composition.
15111510 Borderline significant differences of four-loci haplotype distributions in downstream haplotype block. Haplotype associated with strongest insulin response to glucose conferred lowest risk of type 2 diabetes.
14978033 an interdependent ERRalpha/PGC-1alpha-based transcriptional pathway targets the ESRRA23 element to dictate ERRalpha expression level; regulatory polymorphism studied may provide differential responses to ERRalpha/PGC-1alpha-mediated metabolic cues
14670614 our data suggest that the transcriptional activity of PPARgamma may not only be decreased by mutation but also by downregulation of the coactivator PGC-1 of PPARgamma.
14652494 Observational study of gene-disease association. (HuGE Navigator)
14652494 Examines whether common polymorphism (Gly482Ser) within the gene modifies the association between physical activity energy expenditure and VO2max
14633846 Increases in PGC-1 and PPAR-alpha levels may play an important role in changes in muscle mitochondria content, oxidative phenotype, and sensitivity to insulin induced by endurance training.
14574455 Polymorphism associated with insulin resistance affects insulin snssitivity by interacting with PC-1 polymorphism
14522988 PGC-1alpha has a fundamental role in activating CYP7A1 and bile acid biosynthesis
12972445 in human skeletal muscle, PGC-1alpha mRNA increased more after exercise with restricted blood flow than in the nonrestricted condition.
12866036 Down-regulation of peroxisome-proliferator activated receptor-gamma coactivator 1 is associated with local recurrence and metastasis in breast cancer
12832613 Decreased PGC1 expression may be responsible for decreased expression of NRF-dependent genes, leading to the metabolic disturbances characteristic of insulin resistance and DM.
12606537 Observational study of gene-disease association. (HuGE Navigator)
12606537 data indicate that the Gly482Ser missense polymorphism in PGC-1 has metabolic consequences on lipid metabolism that could influence insulin secretion
12606503 results indicate that signaling via protein kinase B to forkhead transcription factor FKHR can account for the effect of insulin to regulate peroxisome proliferator-activated receptor-gamma coactivator-1 promoter activity via the insulin response sequence
12574109 Observational study of gene-disease association. (HuGE Navigator)
12574109 PPARGC1 can participate in blood pressure control, and sequence substitutions at its gene locus confer an increased risk of hypertension to a substantial proportion of men.
12565902 Data describe the expression of peroxisome proliferator-activated receptor gamma (PPAR gamma) co-activator 1, PPAR gamma, insulin receptor substrate-1, glucose transporter isoform-4, and mitochondrial uncoupling protein-1 in adipose tissue.
12563009 Exercise induces dramatic transient increase in PGC-1alpha transcription and mRNA content in human skeletal muscle. PGC-1alpha may coordinate activation of metabolic genes in human muscle in response to exercise.
12522104 PGC-1 can induce the fatty acid oxidation enzyme MCAD (medium-chain acyl-coenzyme A dehydrogenase) in an ERRalpha-dependent manner
12502716 role of LXXLL domain for ligand-dependent and ligand-independent interaction and coactivation of peroxisome proliferator-activated receptor gamma
12470296 PGC-1 alpha serves as a co-activator for the liver X receptor (LXR) alpha, known to contribute to the regulation of cellular cholesterol homoeostasis
12397057 identification of a specific molecular repressor of the gene
12107756 Observational study of gene-disease association. (HuGE Navigator)
12107756 results of this study suggested that the PGC-1 gene might be implicated in the pathogenesis of Type II diabetes
12032643 no association with type II diabetes and G482S polymorphism was detected in moderate and morbidly obese subjects
12011097 Egr-1 is necessary and sufficient to activate human PPARgamma1 gene expression in VSMC
11916956 Observational study of gene-disease association. (HuGE Navigator)
11875072 Peroxisome proliferator-activated receptor (PPAR) gamma coactivator-1 recruitment regulates PPAR subtype specificity.
11793024 Mutation analysis. A widespread Gly482Ser polymorphism of PGC-1 is associated with a 1.34 genotype relative risk of Type II diabetes mellitus
11340167 PRC is a functional relative of PGC-1 that operates through NRF-1 and possibly other activators in response to proliferative signals
11158005 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSDQSEIISNQYN      1 - 70
NEPSNIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDGDVTTDNEASPSSMPDGTPPPQEAEE     71 - 140
PSLLKKLLLAPANTQLSYNECSGLSTQNHANHNHRIRTNPAIVKTENSWSNKAKSICQQQKPQRRPCSEL    141 - 210
LKYLTTNDDPPHTKPTENRNSSRDKCTSKKKSHTQSQSQHLQAKPTTLSLPLTPESPNDPKGSPFENKTI    211 - 280
ERTLSVELSGTAGLTPPTTPPHKANQDNPFRASPKLKSSCKTVVPPPSKKPRYSESSGTQGNNSTKKGPE    281 - 350
QSELYAQLSKSSVLTGGHEERKTKRPSLRLFGDHDYCQSINSKTEILINISQELQDSRQLENKDVSSDWQ    351 - 420
GQICSSTDSDQCYLRETLEASKQVSPCSTRKQLQDQEIRAELNKHFGHPSQAVFDDEADKTGELRDSDFS    421 - 490
NEQFSKLPMFINSGLAMDGLFDDSEDESDKLSYPWDGTQSYSLFNVSPSCSSFNSPCRDSVSPPKSLFSQ    491 - 560
RPQRMRSRSRSFSRHRSCSRSPYSRSRSRSPGSRSSSRSCYYYESSHYRHRTHRNSPLYVRSRSRSPYSR    561 - 630
RPRYDSYEEYQHERLKREEYRREYEKRESERAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVF    631 - 700
GEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDD    701 - 770
FDPASTKSKYDSLDFDSLLKEAQRSLRR                                              771 - 798
//

Text Mined References (472)

PMID Year Title
27456910 2016 Combined speed endurance and endurance exercise amplify the exercise-induced PGC-1? and PDK4 mRNA response in trained human muscle.
27436584 2016 Impact of adrenaline and metabolic stress on exercise-induced intracellular signaling and PGC-1? mRNA response in human skeletal muscle.
27143380 [The level of circulating PGC1a in cardiovascular disease].
27033444 2016 A key role of PGC-1? transcriptional coactivator in production of VEGF by a novel angiogenic agent COA-Cl in cultured human fibroblasts.
27022023 2016 The Methionine Transamination Pathway Controls Hepatic Glucose Metabolism through Regulation of the GCN5 Acetyltransferase and the PGC-1? Transcriptional Coactivator.
27015186 2016 Interactions of a PPARGC1A Variant and a PNPLA3 Variant Affect Nonalcoholic Steatohepatitis in Severely Obese Taiwanese Patients.
26982719 2016 PGC1? drives NAD biosynthesis linking oxidative metabolism to renal protection.
26962700 2016 PGC-1? Induces Human RPE Oxidative Metabolism and Antioxidant Capacity.
26831453 2016 Sirt1 and the Mitochondria.
26797282 2016 Carvedilol promotes mitochondrial biogenesis by regulating the PGC-1/TFAM pathway in human umbilical vein endothelial cells (HUVECs).
26676891 2016 Application of recombinant peroxisome proliferator-activated receptor-? coactivator-1? mediates neovascularization in the retina.
26665595 2015 [Relationship between hepatitis C virus and the transcription coactivator PGC-1?--A review].
26572168 2016 Training intensity modulates changes in PGC-1? and p53 protein content and mitochondrial respiration, but not markers of mitochondrial content in human skeletal muscle.
26466083 2015 A comparison of PGC-1? mRNA and protein expression in response to 1-week endurance training on alternate days or 4 consecutive days.
26438876 2015 Direct link between metabolic regulation and the heat-shock response through the transcriptional regulator PGC-1?.
26427438 2016 The Potential Use of PGC-1? and PGC-1? to Protect the Retina by Stimulating Mitochondrial Repair.
26386696 2015 BMI-related progression of atypical PKC-dependent aberrations in insulin signaling through IRS-1, Akt, FoxO1 and PGC-1? in livers of obese and type 2 diabetic humans.
26380295 2015 Gene Network Analysis of Glucose Linked Signaling Pathways and Their Role in Human Hepatocellular Carcinoma Cell Growth and Survival in HuH7 and HepG2 Cell Lines.
26365176 2015 MYC/PGC-1? Balance Determines the Metabolic Phenotype and Plasticity of Pancreatic Cancer Stem Cells.
26363853 2015 PGC-1? controls mitochondrial biogenesis and dynamics in lead-induced neurotoxicity.
26317511 2015 PGC-1? Promoter Methylation in Parkinson's Disease.
26315270 2015 GLP-1 contributes to increases in PGC-1? expression by downregulating miR-23a to reduce apoptosis.
26244551 2015 ?v?5 Integrin/FAK/PGC-1? Pathway Confers Protective Effects on Retinal Pigment Epithelium.
26191154 2015 Lack of PGC-1? exacerbates high glucose-induced apoptosis in human umbilical vein endothelial cells through activation of VADC1.
26185753 2015 The 482Ser of PPARGC1A and 12Pro of PPARG2 Alleles Are Associated with Reduction of Metabolic Risk Factors Even Obesity in a Mexican-Mestizo Population.
26123583 2015 Activation of FoxO1/ PGC-1? prevents mitochondrial dysfunction and ameliorates mesangial cell injury in diabetic rats.
26119730 2015 Suppression of PGC-1? Is Critical for Reprogramming Oxidative Metabolism in Renal Cell Carcinoma.
26117405 2015 MicroRNA-19b/221/222 induces endothelial cell dysfunction via suppression of PGC-1? in the progression of atherosclerosis.
26089547 2015 Rapidly elevated levels of PGC-1?-b protein in human skeletal muscle after exercise: exploring regulatory factors in a randomized controlled trial.
25982469 2015 A single bout of whole-leg, peristaltic pulse external pneumatic compression upregulates PGC-1? mRNA and endothelial nitric oxide sythase protein in human skeletal muscle tissue.
25977930 2015 Genetic Associations of PPARGC1A with Type 2 Diabetes: Differences among Populations with African Origins.
25928419 2015 Polymorphisms of the peroxisome proliferator-activated receptor-? (rs1801282) and its coactivator-1 (rs8192673) are associated with obesity indexes in subjects with type 2 diabetes mellitus.
25886402 2015 The single nucleotide polymorphism Gly482Ser in the PGC-1? gene impairs exercise-induced slow-twitch muscle fibre transformation in humans.
25875376 2015 Placental DNA methylation of peroxisome-proliferator-activated receptor-? co-activator-1? promoter is associated with maternal gestational glucose level.
25808897 2015 Peroxisome Proliferator Activated Receptor Gamma Coactivator 1 Alpha: An Emerging Target for Neuroprotection in Parkinson's Disease.
25789761 2015 SIRT1/PGC-1? signaling protects hepatocytes against mitochondrial oxidative stress induced by bile acids.
25779952 2015 SIRT1/PGC1?-Dependent Increase in Oxidative Phosphorylation Supports Chemotherapy Resistance of Colon Cancer.
25773007 2015 The influence of ethnicity in the association of WC, WHR, hypertension and PGC-1? (Gly482Ser), UCP2 -866 G/A and SIRT1 -1400 T/C polymorphisms with T2D in the population of Punjab.
25772858 2015 Patulin triggers NRF2-mediated survival mechanisms in kidney cells.
25753246 2015 Metabolic roles of PGC-1? and its implications for type 2 diabetes.
25748950 2015 Association between the PPARGC1A polymorphism and aerobic capacity in Japanese middle-aged men.
25695395 2015 PGC-1? is responsible for survival of multiple myeloma cells under hyperglycemia and chemotherapy.
25595716 2015 MicroRNA-130a can inhibit hepatitis B virus replication via targeting PGC1? and PPAR?.
25585584 2015 Overexpression of PGC?1? enhances cell proliferation and tumorigenesis of HEK293 cells through the upregulation of Sp1 and Acyl-CoA binding protein.
25565653 2015 The role of alterations in mitochondrial dynamics and PGC-1? over-expression in fast muscle atrophy following hindlimb unloading.
25522631 2014 [Mongolian medicine cha gan beng ga regulated activity of biomarker PGC-1?].
25516445 2015 Overexpression of PGC1? and accumulation of p62 in apocrine carcinoma of the breast.
25486838 [The role of PGC-1? in regulation of skeletal muscle metabolism].
25470625 The Gly482Ser polymorphism of the peroxisome proliferator-activated receptor-? coactivator-1? (PGC-1?) is associated with type 2 diabetes in Tunisian population.
25434963 2015 Inhibition of PGC-1? after chemotherapy-mediated insult confines multiple myeloma cell survival by affecting ROS accumulation.
25389293 2015 Relaxin activates peroxisome proliferator-activated receptor ? (PPAR?) through a pathway involving PPAR? coactivator 1? (PGC1?).
25363075 2015 Mutual exacerbation of peroxisome proliferator-activated receptor ? coactivator 1? deregulation and ?-synuclein oligomerization.
25339750 2014 PGC-1? provides a transcriptional framework for synchronous neurotransmitter release from parvalbumin-positive interneurons.
25324196 2014 Genetic variants in ICAM1, PPARGC1A and MTHFR are potentially associated with different phenotypes of diabetic retinopathy.
25282005 2015 Association between PGC-1alpha gene polymorphisms and type 2 diabetes risk: a case-control study of an Iranian population.
25260493 2014 Potential roles of PINK1 for increased PGC-1?-mediated mitochondrial fatty acid oxidation and their associations with Alzheimer disease and diabetes.
25259918 2014 Skeletal muscle PGC-1?1 modulates kynurenine metabolism and mediates resilience to stress-induced depression.
25243473 2014 Expression of mitochondrial regulators PGC1? and TFAM as putative markers of subtype and chemoresistance in epithelial ovarian carcinoma.
25241037 2014 PGC-1? mediates mitochondrial biogenesis and oxidative phosphorylation in cancer cells to promoteĀ metastasis.
25204433 2015 Isoform-specific SCF(Fbw7) ubiquitination mediates differential regulation of PGC-1?.
25192891 2014 New gene targets of PGC-1? and ERR? co-regulation in C2C12 myotubes.
25118933 2014 The protease Omi regulates mitochondrial biogenesis through the GSK3?/PGC-1? pathway.
25112714 2014 FNDC5 could be regulated by leptin in adipose tissue.
25099937 2014 Ethanol suppresses PGC-1? expression by interfering with the cAMP-CREB pathway in neuronal cells.
25047750 2014 Peroxisome proliferator-activated receptor ? coactivator 1? and FoxO3A mediate chondroprotection by AMP-activated protein kinase.
25009290 2014 PGC-1? induces SPP1 to activate macrophages and orchestrate functional angiogenesis in skeletal muscle.
24996283 2014 PPAR-? and PPARGC1A gene variants have strong effects on aerobic performance of Turkish elite endurance athletes.
24995979 2014 IRF4 is a key thermogenic transcriptional partner of PGC-1?.
24928019 2014 [Screening of variation in the promoter of PPARGC1A gene and study of its association with the risk of type 2 diabetes in ethnic Hans from Beijing].
24907054 2014 Exercise-induced expression of peroxisome proliferator-activated receptor ? coactivator-1? isoforms in skeletal muscle of endurance-trained males.
24837562 Altered promoter methylation of PDK4, IL1 B, IL6, and TNF after Roux-en Y gastric bypass.
24819348 2014 Expression of adenine nucleotide translocase (ANT) isoform genes is controlled by PGC-1? through different transcription factors.
24812272 2014 Targeting mitochondrial oxidative metabolism in melanoma causes metabolic compensation through glucose and glutamine utilization.
24800995 2014 Truncated splice variant PGC-1?4 is not associated with exercise-induced human muscle hypertrophy.
24776744 2014 Maintaining PGC-1? expression following pressure overload-induced cardiac hypertrophy preserves angiogenesis but not contractile or mitochondrial function.
24718382 2014 Impact of the PPARGC1A Gly482Ser polymorphism on left ventricular structural and functional abnormalities in patients with hypertension.
24699405 2014 Inadequate mito-biogenesis in primary dermal fibroblasts from old humans is associated with impairment of PGC1A-independent stimulation.
24698981 2014 NRIP1/RIP140 siRNA-mediated attenuation counteracts mitochondrial dysfunction in Down syndrome.
24654751 2014 Peroxisome proliferator-activated receptor gamma, coactivator 1? enhances local estrogen biosynthesis by stimulating aromatase activity in endometriosis.
24622795 2014 PGC1? promoter methylation in blood at 5-7 years predicts adiposity from 9 to 14 years (EarlyBird 50).
24583643 2014 RIP1 maintains DNA integrity and cell proliferation by regulating PGC-1?-mediated mitochondrial oxidative phosphorylation and glycolysis.
24561815 2014 Postexercise muscle cooling enhances gene expression of PGC-1?.
24554339 2014 Low mitochondrial DNA content associates with familial longevity: the Leiden Longevity Study.
24529027 2014 CRTC2 enhances HBV transcription and replication by inducing PGC1? expression.
24510228 2014 A PGC-1?- and muscle fibre type-related decrease in markers of mitochondrial oxidative metabolism in skeletal muscle of humans with inherited insulin resistance.
24508229 2014 PGC-1? signaling coordinates susceptibility to metabolic and oxidative injury in the inner retina.
24503013 2014 HIF-1? and HIF-2? are critically involved in hypoxia-induced lipid accumulation in hepatocytes through reducing PGC-1?-mediated fatty acid ?-oxidation.
24472748 2014 Regulation of mitochondrial proliferation by PGC-1? induces cellular apoptosis in musculoskeletal malignancies.
24463787 2014 Impaired myocardium energetics associated with the risk for new-onset atrial fibrillation after isolated coronary artery bypass graft surgery.
24457025 2014 Development of a stable cell line with an intact PGC-1?/ERR? axis for screening environmental chemicals.
24444220 2014 Variation in the ACE, PPARGC1A and PPARA genes in Lithuanian football players.
24430439 2014 Exercise prevents maternal high-fat diet-induced hypermethylation of the Pgc-1? gene and age-dependent metabolic dysfunction in the offspring.
24403067 2014 Decorin induces mitophagy in breast carcinoma cells via peroxisome proliferator-activated receptor ? coactivator-1? (PGC-1?) and mitostatin.
24402435 2014 PGC-1? integrates glucose metabolism and angiogenesis in multiple myeloma cells by regulating VEGF and GLUT-4.
24398293 2014 PGC-1? overexpression exacerbates ?-amyloid and tau deposition in a transgenic mouse model of Alzheimer's disease.
24383721 2014 A single nucleotide polymorphism in the coding region of PGC-1? is a male-specific modifier of Huntington disease age-at-onset in a large European cohort.
24371810 2013 PGC-1? and reactive oxygen species regulate human embryonic stem cell-derived cardiomyocyte function.
24317794 2014 Common variation at PPARGC1A/B and change in body composition and metabolic traits following preventive interventions: the Diabetes Prevention Program.
24297698 2014 The metabolic sensors FXR?, PGC-1?, and SIRT1 cooperatively regulate hepatitis B virus transcription.
24293320 2014 Sphingosine 1-phosphate (S1P) promotes mitochondrial biogenesis in Hep G2 cells by activating Peroxisome proliferator-activated receptor ? coactivator 1? (PGC-1?).
24262291 2014 PPARGC1A DNA methylation in subcutaneous adipose tissue in low birth weight subjects--impact of 5 days of high-fat overfeeding.
24237962 2014 The effects of acute and chronic exercise on PGC-1?, irisin and browning of subcutaneous adipose tissue in humans.
24204994 2013 Downregulation of nuclear-encoded genes of oxidative metabolism in dialyzed chronic kidney disease patients.
24186207 2014 Androgens regulate prostate cancer cell growth via an AMPK-PGC-1?-mediated metabolic switch.
23964012 2013 Macrophage PPAR gamma Co-activator-1 alpha participates in repressing foam cell formation and atherosclerosis in response to conjugated linoleic acid.
23954821 2013 Mitochondrial-related gene expression profiles suggest an important role of PGC-1alpha in the compensatory mechanism of endemic dilated cardiomyopathy.
23951207 2013 Dissociation of increases in PGC-1? and its regulators from exercise intensity and muscle activation following acute exercise.
23949615 2014 Gene expression profiling in subcutaneous, visceral and epigastric adipose tissues of patients with extreme obesity.
23943793 2014 Elevated FGF21 secretion, PGC-1? and ketogenic enzyme expression are hallmarks of iron-sulfur cluster depletion in human skeletal muscle.
23918034 2014 Genome-wide association study (GWAS) for molar-incisor hypomineralization (MIH).
23913178 2013 GCN5 acetyltransferase inhibits PGC1?-induced hepatitis B virus biosynthesis.
23836911 2013 Peroxisome proliferator-activated receptor ? coactivator 1 (PGC-1)- and estrogen-related receptor (ERR)-induced regulator in muscle 1 (Perm1) is a tissue-specific regulator of oxidative capacity in skeletal muscle cells.
23788330 2013 Estrogen-related receptor alpha interacts cooperatively with peroxisome proliferator-activated receptor-gamma coactivator-1alpha to regulate osteocalcin gene expression.
23669350 2013 PGC-1? is a male-specific disease modifier of human and experimental amyotrophic lateral sclerosis.
23648480 2013 The protein level of PGC-1?, a key metabolic regulator, is controlled by NADH-NQO1.
23602251 2013 Gly482Ser mutation impairs the effects of peroxisome proliferator-activated receptor ? coactivator-1? on decreasing fat deposition and stimulating phosphoenolpyruvate carboxykinase expression in hepatocytes.
23505498 2013 Does DNA methylation of PPARGC1A influence insulin action in first degree relatives of patients with type 2 diabetes?
23477830 2013 Oncogenic BRAF regulates oxidative metabolism via PGC1? and MITF.
23438894 2013 PGC-1? regulates hepatic hepcidin expression and iron homeostasis in response to inflammation.
23438722 2013 Effects of post-exercise recovery in a cold environment on muscle glycogen, PGC-1?, and downstream transcription factors.
23426382 2013 The role of genetic variants in CYP2C8, LPIN1, PPARGC1A and PPAR? on the trough steady-state plasma concentrations of rosiglitazone and on glycosylated haemoglobin A1c in type 2 diabetes.
23416000 2013 PGC1? expression defines a subset of human melanoma tumors with increased mitochondrial capacity and resistance to oxidative stress.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23354620 2013 Association of genes involved in bile acid synthesis with the progression of primary biliary cirrhosis in Japanese patients.
23335958 2013 DNA sequence variants in PPARGC1A, a gene encoding a coactivator of the ?-3 LCPUFA sensing PPAR-RXR transcription complex, are associated with NV AMD and AMD-associated loci in genes of complement and VEGF signaling pathways.
23312803 2013 Nicotinamide riboside restores cognition through an upregulation of proliferator-activated receptor-? coactivator 1? regulated ?-secretase 1 degradation and mitochondrial gene expression in Alzheimer's mouse models.
23285255 2012 Short-term intensified cycle training alters acute and chronic responses of PGC1? and Cytochrome C oxidase IV to exercise in human skeletal muscle.
23277535 2012 PGC1? and mitochondrial metabolism--emerging concepts and relevance in ageing and neurodegenerative disorders.
23269818 2013 A common variant in the peroxisome proliferator-activated receptor-? coactivator-1? gene is associated with nonalcoholic fatty liver disease in obese children.
23217713 2012 A PGC-1? isoform induced by resistance training regulates skeletal muscle hypertrophy.
23201126 2013 PGC-1 coactivators regulate MITF and the tanning response.
23178651 2013 Garlic-derived diallyl disulfide modulates peroxisome proliferator activated receptor gamma co-activator 1 alpha in neuroblastoma cells.
23175776 2013 PPAR? coactivator-1? contributes to exercise-induced regulation of intramuscular lipid droplet programming in mice and humans.
23150719 2012 Regulation of mitochondrial oxidative metabolism by tumor suppressor FLCN.
23086295 2013 Combined whole-body vibration, resistance exercise, and sustained vascular occlusion increases PGC-1? and VEGF mRNA abundances.
23073717 2013 Reduced expression of PGC-1? partly underlies mitochondrial changes and correlates with neuronal loss in multiple sclerosis cortex.
23050972 2012 Role of PGC-1? signaling in skeletal muscle health and disease.
22974658 2013 Distinct ligand-dependent and independent modes of thyroid hormone receptor (TR)/PGC-1? interaction.
22939990 2012 PGC-1 proteins and heart failure.
22861165 2013 p53 orchestrates the PGC-1?-mediated antioxidant response upon mild redox and metabolic imbalance.
22825315 2012 Population stratification may bias analysis of PGC-1? as a modifier of age at Huntington disease motor onset.
22732512 2012 The metabolic regulator PGC-1? links hepatitis C virus infection to hepatic insulin resistance.
22684233 2012 Association of the PGC-1? rs8192678 variant with microalbuminuria in subjects with type 2 diabetes mellitus.
22652814 2012 An exonic peroxisome proliferator-activated receptor-? coactivator-1? variation may mediate the resting energy expenditure through a potential regulatory role on important gene expression in this pathway.
22589246 2012 A greatly extended PPARGC1A genomic locus encodes several new brain-specific isoforms and influences Huntington disease age of onset.
22589185 2012 Impaired ubiquitin-proteasome-mediated PGC-1? protein turnover and induced mitochondrial biogenesis secondary to complex-I deficiency.
22392034 2012 The role of PGC-1 and Apo?4 in insomnia.
22340220 2011 Down-regulation of peroxisome proliferator-activated receptor ? coactivator-1? expression in fatty acid-induced pancreatic beta-cell apoptosis involves nuclear factor-?B pathway.
22333269 2012 Lower expression of HNF4? and PGC1? might impair rifampicin-mediated CYP3A4 induction under conditions where PXR is overexpressed in human fetal liver cells.
22310107 2012 Gene variants in PPARD and PPARGC1A are associated with timing of natural menopause in the general Japanese population.
22285815 2012 The diverse role of the PPAR? coactivator 1 family of transcriptional coactivators in cancer.
22267390 2012 Matched work high-intensity interval and continuous running induce similar increases in PGC-1? mRNA, AMPK, p38, and p53 phosphorylation in human skeletal muscle.
22266114 2012 PGC-1? promotes the growth of ErbB2/Neu-induced mammary tumors by regulating nutrient supply.
22247001 2012 ACE I/D, ACTN3 R577X, PPARD T294C and PPARGC1A Gly482Ser polymorphisms and physical fitness in Taiwanese late adolescent girls.
22212273 2011 Peroxisomal proliferator-activated receptor gamma co-activator-1 alpha gene expression increases above the lactate threshold in human skeletal muscle.
22194199 2011 Association between peroxisome proliferator-activated receptor gamma coactivator-1 alpha polymorphism and hypertension in Mongolians in Inner Mongolia.
22122487 2012 The PPARGC1A gene Gly482Ser in Polish and Russian athletes.
22113536 2012 Human mRNA response to exercise and temperature.
22106445 2012 HTR1B, ADIPOR1, PPARGC1A, and CYP19A1 and obesity in a cohort of Caucasians and African Americans: an evaluation of gene-environment interactions and candidate genes.
22102466 2011 PGC-1? protects neurons and alters disease progression in an amyotrophic lateral sclerosis mouse model.
22087236 2011 Induction of PGC-1? expression can be detected in blood samples of patients with ST-segment elevation acute myocardial infarction.
22064484 2012 RNF34 is a cold-regulated E3 ubiquitin ligase for PGC-1? and modulates brown fat cell metabolism.
22052997 2011 Circadian metabolic regulation through crosstalk between casein kinase 1? and transcriptional coactivator PGC-1?.
22049338 2011 Disorder-to-order transition underlies the structural basis for the assembly of a transcriptionally active PGC-1?/ERR? complex.
22016516 2011 The metabolic regulator PGC-1? directly controls the expression of the hypothalamic neuropeptide oxytocin.
22009745 2011 Characterization of novel peroxisome proliferator-activated receptor ? coactivator-1? (PGC-1?) isoform in human liver.
21994947 2011 Curcumin differentially regulates endoplasmic reticulum stress through transcriptional corepressor SMILE (small heterodimer partner-interacting leucine zipper protein)-mediated inhibition of CREBH (cAMP responsive element-binding protein H).
21918181 2012 Remodeling of calcium handling in skeletal muscle through PGC-1?: impact on force, fatigability, and fiber type.
21914785 2011 PGC1? promotes tumor growth by inducing gene expression programs supporting lipogenesis.
21894159 2012 PGC1? gene Gly482Ser polymorphism predicts improved metabolic, inflammatory and vascular outcomes following bariatric surgery.
21883960 2012 The effect of continuous and interval exercise on PGC-1? and PDK4 mRNA in type I and type II fibres of human skeletal muscle.
21880746 2011 Role of peroxisome proliferator-activated receptor gamma coactivator 1alpha in AKT/PKB-mediated inhibition of hepatitis B virus biosynthesis.
21862870 2011 Bax is necessary for PGC1? pro-apoptotic effect in colorectal cancer cells.
21862727 2011 Alternative splice variant PGC-1?-b is strongly induced by exercise in human skeletal muscle.
21784897 2011 IHG-1 promotes mitochondrial biogenesis by stabilizing PGC-1?.
21757867 2011 Truncated peroxisome proliferator-activated receptor-? coactivator 1? splice variant is severely altered in Huntington's disease.
21733854 2011 DNA damage induces down-regulation of PEPCK and G6P gene expression through degradation of PGC-1alpha.
21687738 2011 Differential expression of PGC-1? and metabolic sensors suggest age-dependent induction of mitochondrial biogenesis in Friedreich ataxia fibroblasts.
21595954 2011 Association of PGC-1alpha polymorphisms with age of onset and risk of Parkinson's disease.
21486805 2011 Striated muscle activator of Rho signalling (STARS) is a PGC-1?/oestrogen-related receptor-? target gene and is upregulated in human skeletal muscle after endurance exercise.
21467224 2011 Peroxisome proliferator-activated receptor-gamma coactivator 1-alpha (PGC1alpha) is a metabolic regulator of intestinal epithelial cell fate.
21451146 2011 An acute bout of high-intensity interval training increases the nuclear abundance of PGC-1? and activates mitochondrial biogenesis in human skeletal muscle.
21447778 2011 Inherited variants in mitochondrial biogenesis genes may influence epithelial ovarian cancer risk.
21376232 2011 PARIS (ZNF746) repression of PGC-1? contributes to neurodegeneration in Parkinson's disease.
21358044 2011 PPAR? co-activator-1? (PGC-1?) reduces amyloid-? generation through a PPAR?-dependent mechanism.
21294239 2011 Association of peroxisome proliferator-activated receptor gamma coactivator 1 alpha (PPARGC1A) gene polymorphisms and type 2 diabetes mellitus: a meta-analysis.
21244673 2011 Testing the thrifty gene hypothesis: the Gly482Ser variant in PPARGC1A is associated with BMI in Tongans.
21215313 2011 Mitochondrial defect and PGC-1? dysfunction in parkin-associated familial Parkinson's disease.
21187426 2011 The Pim protein kinases regulate energy metabolism and cell growth.
20952631 2010 Association of single-nucleotide polymorphisms from 17 candidate genes with baseline symptom-limited exercise test duration and decrease in duration over 20 years: the Coronary Artery Risk Development in Young Adults (CARDIA) fitness study.
20944660 2011 SNP-by-fitness and SNP-by-BMI interactions from seven candidate genes and incident hypertension after 20 years of follow-up: the CARDIA Fitness Study.
20931535 2010 [PPARGC1A gene Thr394Thr G/A polymorphism and its association with type 2 diabetes mellitus and insulin resistance in a Chinese population].
20890895 2010 Epigenetic regulation of insulin resistance in nonalcoholic fatty liver disease: impact of liver methylation of the peroxisome proliferator-activated receptor ? coactivator 1? promoter.
20884884 2010 PGC-1 coactivators in cardiac development and disease.
20851810 2011 Baicalin increases VEGF expression and angiogenesis by activating the ERR{alpha}/PGC-1{alpha} pathway.
20816721 2010 Estrogens repress PGC1-? expression in the uterus.
20733583 2011 Associations of markers in 11 obesity candidate genes with maximal weight loss and weight regain in the SOS bariatric surgery cases.
20732852 2010 Positive correlation between PPARgamma/PGC-1alpha and gamma-GCS in lungs of rats and patients with chronic obstructive pulmonary disease.
20716531 2010 Peroxisome proliferator-activated receptor {gamma} coactivator 1{alpha} (PGC-1{alpha}) promotes skeletal muscle lipid refueling in vivo by activating de novo lipogenesis and the pentose phosphate pathway.
20713359 2010 Ubiquitin proteasome-dependent degradation of the transcriptional coactivator PGC-1{alpha} via the N-terminal pathway.
20682687 2010 Common variants in 40 genes assessed for diabetes incidence and response to metformin and lifestyle intervention in the diabetes prevention program.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20670916 2010 cAMP-mediated regulation of HNF-4alpha depends on the level of coactivator PGC-1alpha.
20661474 2010 Sirtuin 3, a new target of PGC-1alpha, plays an important role in the suppression of ROS and mitochondrial biogenesis.
20647061 2011 Mitochondrial biogenesis related endurance genotype score and sports performance in athletes.
20638986 2010 Peroxisome proliferator activated receptor alpha (PPARalpha) and PPAR gamma coactivator (PGC-1alpha) induce carnitine palmitoyltransferase IA (CPT-1A) via independent gene elements.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20551328 2010 Peroxisome proliferator-activated receptor-gamma coactivator-1alpha (PGC-1alpha) stimulates VLDL assembly through activation of cell death-inducing DFFA-like effector B (CideB).
20531298 2010 Reversible acetylation of PGC-1: connecting energy sensors and effectors to guarantee metabolic flexibility.
20512451 2010 Association of the CYBA, PPARGC1A, PPARG3, and PPARD gene variants with coronary artery disease and metabolic risk factors of coronary atherosclerosis in a Russian population.
20498286 2010 Effects of the peroxisome proliferator activated receptor-? coactivator-1? (PGC-1?) Thr394Thr and Gly482Ser polymorphisms on rosiglitazone response in Chinese patients with type 2 diabetes mellitus.
20492333 2010 Influence of polygenetic polymorphisms on the susceptibility to non-alcoholic fatty liver disease of Chinese people.
20477822 2011 Single-nucleotide polymorphisms within the antioxidant defence system and associations with aggressive prostate cancer.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20448046 2010 Peroxisome proliferator-activated receptor gamma co-activator 1alpha (PGC-1alpha) and sirtuin 1 (SIRT1) reside in mitochondria: possible direct function in mitochondrial biogenesis.
20437825 2010 Relationship of five type 2 diabetes candidate gene polymorphisms to the age at diagnosis of diabetes in the Slovakian population.
20426853 2010 Association and interaction of PPAR-complex gene variants with latent traits of left ventricular diastolic function.
20401754 2010 PGC-1alpha-mediated adaptations in skeletal muscle.
20384434 2010 Combining genetic markers and clinical risk factors improves the risk assessment of impaired glucose metabolism.
20383327 2010 PGC-1alpha down-regulation affects the antioxidant response in Friedreich's ataxia.
20371735 2010 PGC-1alpha regulation by exercise training and its influences on muscle function and insulin sensitivity.
20368732 2010 Hypoxia induces PGC-1? expression and mitochondrial biogenesis in the myocardium of TOF patients.
20308248 2010 Exercise intensity-dependent regulation of peroxisome proliferator-activated receptor coactivator-1 mRNA abundance is associated with differential activation of upstream signalling kinases in human skeletal muscle.
20211864 2010 The p65 subunit of NF-kappaB binds to PGC-1alpha, linking inflammation and metabolic disturbances in cardiac cells.
20200320 2010 Peroxisome proliferator-activated receptor-gamma coactivator-1alpha overexpression increases lipid oxidation in myocytes from extremely obese individuals.
20178833 2010 Reduced expression of peroxisome-proliferator activated receptor gamma coactivator-1alpha enhances alpha-synuclein oligomerization and down regulates AKT/GSK3beta signaling pathway in human neuronal cells that inducibly express alpha-synuclein.
20139785 2010 Relative workload determines exercise-induced increases in PGC-1alpha mRNA.
20133449 2010 PPAR-gamma coactivator-1alpha regulates progesterone production in ovarian granulosa cells with SF-1 and LRH-1.
20130411 2010 Peroxisome proliferator-activated receptor-gamma and its coactivator-1alpha gene polymorphisms in Korean women with polycystic ovary syndrome.
20125101 2010 Glucose levels and genetic variants across transcriptional pathways: interaction effects with BMI.
20106991 2010 Acute endurance exercise increases the nuclear abundance of PGC-1alpha in trained human skeletal muscle.
20067526 2010 Estrogen-related receptor alpha and PGC-1-related coactivator constitute a novel complex mediating the biogenesis of functional mitochondria.
20045142 2010 Common polymorphisms of the peroxisome proliferator-activated receptor-gamma (Pro12Ala) and peroxisome proliferator-activated receptor-gamma coactivator-1 (Gly482Ser) and the response to pioglitazone in Chinese patients with type 2 diabetes mellitus.
20044476 2010 Associations of polymorphisms of eight muscle- or metabolism-related genes with performance in Mount Olympus marathon runners.
20032281 2010 Subjects with early-onset type 2 diabetes show defective activation of the skeletal muscle PGC-1{alpha}/Mitofusin-2 regulatory pathway in response to physical activity.
20005308 2010 Nutrient-dependent regulation of PGC-1alpha's acetylation state and metabolic function through the enzymatic activities of Sirt1/GCN5.
19965780 2010 Peroxisome proliferator-activated receptor-gamma coactivator 1-alpha overexpression prevents endothelial apoptosis by increasing ATP/ADP translocase activity.
19961051 2009 [Gly482Ser polymorphism of the coactivator-1alpha of the activated receptor of peroxisome gamma proliferation in individuals from Maracaibo, Venezuela].
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19914244 2010 Structural activity relationship of flavonoids with estrogen-related receptor gamma.
19913841 2010 Gly482Ser polymorphism in the peroxisome proliferator-activated receptor gamma coactivator-1alpha gene is associated with oxidative stress and abdominal obesity.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19903700 2010 PPARdelta and PGC1alpha act cooperatively to induce haem oxygenase-1 and enhance vascular endothelial cell resistance to stress.
19900151 2010 Association of the PPARGC1A gene polymorphism with diabetic nephropathy in an Asian Indian population (CURES-41).
19884383 2010 Peroxisome proliferator-activated receptor gamma coactivator-1alpha interacts with the androgen receptor (AR) and promotes prostate cancer cell growth by activating the AR.
19876004 2010 Obesity-related polymorphisms and their associations with the ability to regulate fat oxidation in obese Europeans: the NUGENOB study.
19861117 2009 The PGC-1alpha-dependent pathway of mitochondrial biogenesis is upregulated in type I endometrial cancer.
19846556 2009 Multiple binding modes between HNF4alpha and the LXXLL motifs of PGC-1alpha lead to full activation.
19828207 2009 Evaluation of the association between the PPARGC1A genetic polymorphisms and type 2 diabetes in Han Chinese population.
19793822 2009 Peroxisome proliferator-activated receptor gamma Coactivator 1alpha and small heterodimer partner differentially regulate nuclear receptor-dependent hepatitis B virus biosynthesis.
19793803 2009 Distinct regulation of hepatitis B virus biosynthesis by peroxisome proliferator-activated receptor gamma coactivator 1alpha and small heterodimer partner in human hepatoma cell lines.
19723495 2009 Non-CpG methylation of the PGC-1alpha promoter through DNMT3B controls mitochondrial density.
19681917 2010 The role of genetic variation in peroxisome proliferator-activated receptors in the polycystic ovary syndrome (PCOS): an original case-control study followed by systematic review and meta-analysis of existing evidence.
19680556 2009 Genetic variation in healthy oldest-old.
19666693 2009 Is there an interaction between PPARD T294C and PPARGC1A Gly482Ser polymorphisms and human endurance performance?
19653005 2009 The combined impact of metabolic gene polymorphisms on elite endurance athlete status and related phenotypes.
19651776 2009 DAX-1 acts as a novel corepressor of orphan nuclear receptor HNF4alpha and negatively regulates gluconeogenic enzyme gene expression.
19625249 2009 SUMOylation attenuates the function of PGC-1alpha.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19567523 2009 Uncoupling protein-1 and related messenger ribonucleic acids in human epicardial and other adipose tissues: epicardial fat functioning as brown fat.
19536736 2009 Evidence for interaction between PPARG Pro12Ala and PPARGC1A Gly482Ser polymorphisms in determining type 2 diabetes intermediate phenotypes in overweight subjects.
19460884 2009 Impaired PGC-1alpha function in muscle in Huntington's disease.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19451226 2009 Bcl3 interacts cooperatively with peroxisome proliferator-activated receptor gamma (PPARgamma) coactivator 1alpha to coactivate nuclear receptors estrogen-related receptor alpha and PPARalpha.
19446346 2009 The biology of PGC-1? and its therapeutic potential.
19435887 2009 PPAR{delta} agonism activates fatty acid oxidation via PGC-1{alpha} but does not increase mitochondrial gene expression and function.
19422653 2010 Do PPARGC1A and PPARalpha polymorphisms influence sprint or endurance phenotypes?
19422651 2010 Does the polygenic profile determine the potential for becoming a world-class athlete? Insights from the sport of rowing.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19389810 2009 Fasting-induced hepatic production of DHEA is regulated by PGC-1alpha, ERRalpha, and HNF4alpha.
19371772 2009 PGC-1alpha in aging and anti-aging interventions.
19322023 2009 Sterol-independent repression of low density lipoprotein receptor promoter by peroxisome proliferator activated receptor gamma coactivator-1alpha (PGC-1alpha).
19297390 2009 PGC-1alpha/beta induced expression partially compensates for respiratory chain defects in cells from patients with mitochondrial disorders.
19273754 2009 PGC-1alpha expression decreases in the Alzheimer disease brain as a function of dementia.
19265027 2009 Short-term exercise training does not stimulate skeletal muscle ATP synthesis in relatives of humans with type 2 diabetes.
19237423 2009 Is there an optimum endurance polygenic profile?
19233136 2009 Identification and characterization of an alternative promoter of the human PGC-1alpha gene.
19200361 2009 PGC-1alpha as modifier of onset age in Huntington disease.
19183932 2009 PPARGC1A sequence variation and cardiovascular risk-factor levels: a study of the main genetic effects and gene x environment interactions in children from the European Youth Heart Study.
19179292 2009 PGC-1alpha is coupled to HIF-1alpha-dependent gene expression by increasing mitochondrial oxygen consumption in skeletal muscle cells.
19171140 2009 Kaempferol is an estrogen-related receptor alpha and gamma inverse agonist.
19148128 2009 Maternal pregestational BMI is associated with methylation of the PPARGC1A promoter in newborns.
19142226 2009 PGC-1alpha is a key regulator of glucose-induced proliferation and migration in vascular smooth muscle cells.
19118529 2009 Identification of novel targets for PGC-1alpha and histone deacetylase inhibitors in neuroblastoma cells.
19112161 2009 Brief intense interval exercise activates AMPK and p38 MAPK signaling and increases the expression of PGC-1alpha in human skeletal muscle.
19103600 2009 A PGC-1alpha-O-GlcNAc transferase complex regulates FoxO transcription factor activity in response to glucose.
19102936 2008 [Down-regulation of PGC-1alpha expression in human hepatocellular carcinoma].
19077249 2008 The PPARGC1A Gly482Ser polymorphism is associated with left ventricular diastolic dysfunction in men.
19070258 2008 Peroxisome proliferator-activated receptor gamma/Pro12Ala polymorphism and peroxisome proliferator-activated receptor gamma coactivator-1 alpha/Gly482Ser polymorphism in patients with sarcoidosis.
19065516 2008 [Study of the 482G/A variation in PGC-1alpha gene domain MEF2C as possible mechanism of type 2 diabetes].
19061896 2009 PGC-1alpha and ERRalpha target gene downregulation is a signature of the failing human heart.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
19038972 2009 TNF-alpha reduces PGC-1alpha expression through NF-kappaB and p38 MAPK leading to increased glucose oxidation in a human cardiac cell model.
18996470 2009 Rapid and cost effective genotyping method for polymorphisms in PPARG, PPARGC1 and TCF7L2 genes.
18974883 2008 AMP-activated protein kinase-regulated activation of the PGC-1alpha promoter in skeletal muscle cells.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18923559 2008 PGC-1alpha-mediated regulation of gene expression and metabolism: implications for nutrition and exercise prescriptions.
18823672 2008 Enhanced short-term improvement of insulin response to a low-caloric diet in obese carriers the Gly482Ser variant of the PGC-1alpha gene.
18801770 2010 World-class performance in lightweight rowing: is it genetically influenced? A comparison with cyclists, runners and non-athletes.
18798693 2008 Identification of COUP-TFII orphan nuclear receptor as a retinoic acid-activated receptor.
18786524 2008 PPAR-alpha L162V and PGC-1 G482S gene polymorphisms, but not PPAR-gamma P12A, are associated with alcohol consumption in a Spanish Mediterranean population.
18719883 2008 Transcriptional profiling of myotubes from patients with type 2 diabetes: no evidence for a primary defect in oxidative phosphorylation genes.
18689799 2008 Synergistic activation of the human MnSOD promoter by DJ-1 and PGC-1alpha: regulation by SUMOylation and oxidation.
18673300 2008 PGC-1alpha induces dynamic protein interactions on the ERRalpha gene multi-hormone response element nucleosome in kidney cells.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18653753 2008 Rapid exercise-induced changes in PGC-1alpha mRNA and protein in human skeletal muscle.
18614852 2008 PGC-1alpha Gly482Ser polymorphism is associated with the plasma adiponectin level in type 2 diabetic men.
18588668 2008 Association between PPARGC1A polymorphisms and the occurrence of nonalcoholic fatty liver disease (NAFLD).
18565194 2008 Association between PPARGC1A gene polymorphisms and coronary artery disease in a Chinese population.
18563384 2008 Sequence variation between the mouse and human glucose-6-phosphatase catalytic subunit gene promoters results in differential activation by peroxisome proliferator activated receptor gamma coactivator-1alpha.
18501443 2008 The transcriptional co-activator PGC-1alpha up regulates apelin in human and mouse adipocytes.
18469005 2008 Structural and biochemical basis for the binding selectivity of peroxisome proliferator-activated receptor gamma to PGC-1alpha.
18467552 2008 The Gly482Ser genotype at the PPARGC1A gene and elevated blood pressure: a meta-analysis involving 13,949 individuals.
18451773 2008 A decreased mitochondrial DNA content is related to insulin resistance in adolescents.
18441008 2008 Communication between the ERRalpha homodimer interface and the PGC-1alpha binding surface via the helix 8-9 loop.
18438697 2008 Genetic study between SIRT1, PPARD, PGC-1alpha genes and Alzheimer's disease.
18385139 2008 Peroxisome proliferator-activated receptor-gamma coactivator-1alpha activation of CYP7A1 during food restriction and diabetes is still inhibited by small heterodimer partner.
18370824 2007 Absence of Association of Metabolic Syndrome with PPARGC1A, PPARG and UCP1 Gene Polymorphisms in Asian Indians.
18331997 2008 [Association study between PPARGC1A Thr394Thr/ Gly482Ser polymorphisms and type 2 diabetes].
18270681 2008 Epigenetic regulation of PPARGC1A in human type 2 diabetic islets and effect on insulin secretion.
18242180 2008 Peroxisome proliferator-activated receptor gamma coactivator-1 alpha (PGC-1alpha) upregulated E-cadherin expression in HepG2 cells.
18162502 2008 PPARGC1A variation associated with DNA damage, diabetes, and cardiovascular diseases: the Boston Puerto Rican Health Study.
18067759 2007 Association between peroxisome proliferator-activated receptor-gamma coactivator-1alpha gene polymorphisms and type 2 diabetes in southern Chinese population: role of altered interaction with myocyte enhancer factor 2C.
17999673 2008 Effect of peroxisome proliferator-activated receptors-gamma and co-activator-1alpha genetic polymorphisms on plasma adiponectin levels and susceptibility of non-alcoholic fatty liver disease in Chinese people.
17971240 2007 The impact of severity of hypertension on association of PGC-1alpha gene with blood pressure and risk of hypertension.
17926914 2007 [Association of regulatory genes polymorphisms with aerobic and anaerobic performance of athletes].
17907962 2007 Targeting PGC-1 alpha to control energy homeostasis.
17828388 2007 Upregulation of peroxisome proliferator-activated receptor gamma coactivator gene (PGC1A) during weight loss is related to insulin sensitivity but not to energy expenditure.
17701054 2007 Interaction between the UCP2-866G/A, mtDNA 10398G/A and PGC1alpha p.Thr394Thr and p.Gly482Ser polymorphisms in type 2 diabetes susceptibility in North Indian population.
17680531 2007 [The cSNPs analysis in whole extron-wide of PGC-1alpha gene in Chinese population and the domain MEF2C bioinformatics study].
17646210 2007 The transcriptional coactivator peroxisome proliferator activated receptor (PPAR)gamma coactivator-1 alpha and the nuclear receptor PPAR alpha control the expression of glycerol kinase and metabolism genes independently of PPAR gamma activation in human white adipocytes.
17630210 2007 Genotype modulators of clinical severity in McArdle disease.
17579564 2007 Polymorphisms of the peroxisome proliferator-activated receptor-gamma coactivator-1alpha gene are associated with hypertrophic cardiomyopathy and not with hypertension hypertrophy.
17502589 2007 Peroxisome proliferator-activated receptor gamma coactivator-1 (PGC-1) regulatory cascade in cardiac physiology and disease.
17490458 2008 Is there an association between PPARGC1A genotypes and endurance capacity in Chinese men?
17479445 2007 The peroxisome proliferator-activated receptor gamma coactivator-1 alpha gene (PGC-1alpha) is not associated with type 2 diabetes mellitus or body mass index among Hispanic and non Hispanic Whites from Colorado.
17457313 2007 Association analysis of the chromosome 4p15-p16 candidate region for bipolar disorder and schizophrenia.
17418099 2007 Estrogen-related receptor alpha is essential for the expression of antioxidant protection genes and mitochondrial function.
17390150 2007 PGC-1alpha Thr394Thr and Gly482Ser variants are significantly associated with T2DM in two North Indian populations: a replicate case-control study.
17374560 2007 Identification of a novel human glucagon receptor promoter: regulation by cAMP and PGC-1alpha.
17372612 2007 PGC-1alpha induces apoptosis in human epithelial ovarian cancer cells through a PPARgamma-dependent pathway.
17355643 2007 Frequencies of single nucleotide polymorphisms in genes regulating inflammatory responses in a community-based population.
17342473 2007 A variant in the transcription factor 7-like 2 (TCF7L2) gene is associated with an increased risk of gestational diabetes mellitus.
17327880 2007 Identification of a candidate genetic variant for the high prevalence of type II diabetes in Polynesians.
17327385 2007 Genetic variations in PPARD and PPARGC1A determine mitochondrial function and change in aerobic physical fitness and insulin sensitivity during lifestyle intervention.
17322100 2007 Predominance of a proinflammatory phenotype in monocyte-derived macrophages from subjects with low plasma HDL-cholesterol.
17290397 2007 EP1-4 subtype, COX and PPAR gamma receptor expression in colorectal cancer in prediction of disease-specific mortality.
17284167 2007 Characterization of the transactivation domain in the peroxisome-proliferator-activated receptor gamma co-activator (PGC-1).
17241533 2007 Association between SNP and haplotypes in PPARGC1 and adiponectin genes and bone mineral density in Chinese nuclear families.
17216277 2007 PPARGC1A coding variation may initiate impaired NEFA clearance during glucose challenge.
17187763 2007 Analysis of PGC-1alpha variants Gly482Ser and Thr612Met concerning their PPARgamma2-coactivation function.
17150186 2007 Glucocorticoid receptor mediated repression of human insulin gene expression is regulated by PGC-1alpha.
17108241 2006 PGC-1alpha: a key regulator of energy metabolism.
17050673 2006 Defects in energy homeostasis in Leigh syndrome French Canadian variant through PGC-1alpha/LRP130 complex.
17032743 2006 PGC-1alpha regulates the isoform mRNA ratio of the alternatively spliced thyroid hormone receptor alpha transcript.
17018837 2006 Peroxisome proliferator-activated receptor gamma coactivator 1 coactivators, energy homeostasis, and metabolism.
17018277 2006 Transcriptional repression of PGC-1alpha by mutant huntingtin leads to mitochondrial dysfunction and neurodegeneration.
16978381 2006 Large-scale study of the -232C > G polymorphism of PCK1 in Type 2 diabetes.
16978372 2006 The Gly482Ser variant of the PPARGC1 gene is associated with Type 2 diabetes mellitus in northern Chinese, especially men.
16929032 2006 Apolipoprotein A-IV is regulated by nutritional and metabolic stress: involvement of glucocorticoids, HNF-4 alpha, and PGC-1 alpha.
16902166 2006 Associations of PPARGC1A haplotypes with plaque score but not with intima-media thickness of carotid arteries in middle-aged subjects.
16896940 2006 Peroxisome proliferator-activated receptor-gamma coactivator-1 and insulin resistance: acute effect of fatty acids.
16891621 2006 Nitric oxide regulates mitochondrial oxidative stress protection via the transcriptional coactivator PGC-1alpha.
16891307 2006 Underexpressed coactivators PGC1alpha and SRC1 impair hepatocyte nuclear factor 4 alpha function and promote dedifferentiation in human hepatoma cells.
16882880 2006 Transcriptional activation of CYP2C9, CYP1A1, and CYP1A2 by hepatocyte nuclear factor 4alpha requires coactivators peroxisomal proliferator activated receptor-gamma coactivator 1alpha and steroid receptor coactivator 1.
16857725 2006 Induction of human CYP2A6 is mediated by the pregnane X receptor with peroxisome proliferator-activated receptor-gamma coactivator 1alpha.
16804087 2006 Single nucleotide polymorphisms of PPARD in combination with the Gly482Ser substitution of PGC-1A and the Pro12Ala substitution of PPARG2 predict the conversion from impaired glucose tolerance to type 2 diabetes: the STOP-NIDDM trial.
16753578 2006 GCN5 acetyltransferase complex controls glucose metabolism through transcriptional repression of PGC-1alpha.
16752166 2006 PGC-1alpha: a potent transcriptional cofactor involved in the pathogenesis of type 2 diabetes.
16704985 2006 Associations of genetic variants in the estrogen receptor coactivators PPARGC1A, PPARGC1B and EP300 with familial breast cancer.
16631115 2006 Impaired coactivator activity of the Gly482 variant of peroxisome proliferator-activated receptor gamma coactivator-1alpha (PGC-1alpha) on mitochondrial transcription factor A (Tfam) promoter.
16600233 2006 Polymorphisms of the peroxisome proliferator-activated receptor-gamma and its coactivator-1alpha genes in Chinese women with polycystic ovary syndrome.
16494845 2006 The region of CQQQKPQRRP of PGC-1alpha interacts with the DNA-binding complex of FXR/RXRalpha.
16488887 2006 A Prospero-related homeodomain protein is a novel co-regulator of hepatocyte nuclear factor 4alpha that regulates the cholesterol 7alpha-hydroxylase gene.
16474966 2006 Increased risk of obesity associated with the variant allele of the PPARGC1A Gly482Ser polymorphism in physically inactive elderly men.
16446747 2006 Effect of polymorphisms in the PPARGC1A gene on body fat in Asian Indians.
16443502 2006 Peroxisome proliferator-activated receptor gamma coactivator-1alpha gene variations are not associated with gestational diabetes mellitus.
16435105 2006 Meta-analysis of the Gly482Ser variant in PPARGC1A in type 2 diabetes and related phenotypes.
16403952 2005 The Gly482Ser missense mutation of the peroxisome proliferator-activated receptor gamma coactivator-1 alpha (PGC-1 alpha) gene associates with reduced insulin sensitivity in normal and glucose-intolerant obese subjects.
16395669 2006 Validation of the use of DNA pools and primer extension in association studies of sporadic colorectal cancer for selection of candidate SNPs.
16341842 2006 PPARGC1A mRNA levels of in vitro differentiated human skeletal muscle cells are negatively associated with the plasma oleate concentrations of the donors.
16241916 2005 Peroxisome proliferator-activated receptor-gamma co-activator-1alpha (PGC-1alpha) gene polymorphisms and their relationship to Type 2 diabetes in Asian Indians.
16216916 2005 Peroxisome proliferator-activated receptor gamma and its coactivator-1 alpha may be associated with features of the metabolic syndrome in adolescents.
16150865 2006 A single nucleotide in an estrogen-related receptor alpha site can dictate mode of binding and peroxisome proliferator-activated receptor gamma coactivator 1alpha activation of target promoters.
16132959 2005 Fatty acid-induced differential regulation of the genes encoding peroxisome proliferator-activated receptor-gamma coactivator-1alpha and -1beta in human skeletal muscle cells that have been differentiated in vitro.
16123152 2006 The human Na+-taurocholate cotransporting polypeptide gene is activated by glucocorticoid receptor and peroxisome proliferator-activated receptor-gamma coactivator-1alpha, and suppressed by bile acids via a small heterodimer partner-dependent mechanism.
16122961 Effects of the peroxisome proliferator-activated receptor-gamma co-activator-1 Gly482Ser variant on features of the metabolic syndrome.
16086291 2005 [Study on the relationship between polymorphisms of peroxisome proliferators-activated receptor-gamma coactivator-1alpha gene and type 2 diabetes in Shanghai Hans in China].
16051671 2005 Hepatocyte nuclear factor-4alpha regulates the human apolipoprotein AV gene: identification of a novel response element and involvement in the control by peroxisome proliferator-activated receptor-gamma coactivator-1alpha, AMP-activated protein kinase, and mitogen-activated protein kinase pathway.
15964996 2005 Activation of nuclear receptor coactivator PGC-1alpha by arginine methylation.
15937669 2005 Peroxisome proliferator-activated receptor gamma coactivator 1 alpha promoter polymorphisms are associated with early-onset type 2 diabetes mellitus in the Korean population.
15912394 2005 Haplotypes of PPARGC1A are associated with glucose tolerance, body mass index and insulin sensitivity in offspring of patients with type 2 diabetes.
15908514 2005 Coactivation of the human vitamin D receptor by the peroxisome proliferator-activated receptor gamma coactivator-1 alpha.
15864539 2005 Enhanced insulin-stimulated glycogen synthesis in response to insulin, metformin or rosiglitazone is associated with increased mRNA expression of GLUT4 and peroxisomal proliferator activator receptor gamma co-activator 1.
15826954 2005 Distinct amino acid residues may be involved in coactivator and ligand interactions in hepatocyte nuclear factor-4alpha.
15824463 2004 Peroxisome proliferator-activated receptor-gamma coactivator-1alpha polymorphism is not associated with essential hypertension and type 2 diabetes mellitus in Chinese population.
15821111 2005 Estrogen-related receptor-gamma and peroxisome proliferator-activated receptor-gamma coactivator-1alpha regulate estrogen-related receptor-alpha gene expression via a conserved multi-hormone response element.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15784253 2005 The nuclear receptor coactivator PGC-1alpha exhibits modes of interaction with the estrogen receptor distinct from those of SRC-1.
15782399 Gly482Ser polymorphism of the peroxisome proliferator-activated receptor-gamma coactivator-1 gene might be a risk factor for diabetic retinopathy in Slovene population (Caucasians) with type 2 diabetes and the Pro12Ala polymorphism of the PPARgamma gene is not.
15738346 2005 PGC-1alpha Gly482Ser polymorphism associates with hypertension among Danish whites.
15705733 2005 PPARGC1A genotype (Gly482Ser) predicts exceptional endurance capacity in European men.
15649578 2005 Studies of the Gly482Ser polymorphism of the peroxisome proliferator-activated receptor gamma coactivator 1alpha (PGC-1alpha) gene in Danish subjects with the metabolic syndrome.
15599700 2004 The Gly482Ser polymorphism in the peroxisome proliferator-activated receptor-gamma coactivator-1 gene is associated with hypertension in type 2 diabetic men.
15592662 2004 Common polymorphisms of the PPAR-gamma2 (Pro12Ala) and PGC-1alpha (Gly482Ser) genes are associated with the conversion from impaired glucose tolerance to type 2 diabetes in the STOP-NIDDM trial.
15582274 Association analysis between longevity in the Japanese population and polymorphic variants of genes involved in insulin and insulin-like growth factor 1 signaling pathways.
15581067 2004 A Gly482Ser polymorphism of the peroxisome proliferator-activated receptor-gamma coactivator-1 (PGC-1) gene is associated with type 2 diabetes in Caucasians.
15572661 2004 Negative modulation of androgen receptor transcriptional activity by Daxx.
15572376 2005 Amino acids important for ligand specificity of the human constitutive androstane receptor.
15337744 2004 Evidence for ligand-independent transcriptional activation of the human estrogen-related receptor alpha (ERRalpha): crystal structure of ERRalpha ligand binding domain in complex with peroxisome proliferator-activated receptor coactivator-1alpha.
15329387 2005 Ligand-dependent coactivation of the human bile acid receptor FXR by the peroxisome proliferator-activated receptor gamma coactivator-1alpha.
15322103 2004 Ligand-activated pregnane X receptor interferes with HNF-4 signaling by targeting a common coactivator PGC-1alpha. Functional implications in hepatic cholesterol and glucose metabolism.
15254719 2004 The localisation and reduction of nuclear staining of PPARgamma and PGC-1 in human breast cancer.
15146371 2004 The Gly482Ser variant in the peroxisome proliferator-activated receptor gamma coactivator-1 is not associated with diabetes-related traits in non-diabetic German and Dutch populations.
15111510 2004 Complex haplotypes of the PGC-1alpha gene are associated with carbohydrate metabolism and type 2 diabetes.
14978033 2004 A polymorphic autoregulatory hormone response element in the human estrogen-related receptor alpha (ERRalpha) promoter dictates peroxisome proliferator-activated receptor gamma coactivator-1alpha control of ERRalpha expression.
14744933 2004 Suppression of mitochondrial respiration through recruitment of p160 myb binding protein to PGC-1alpha: modulation by p38 MAPK.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14670614 2004 Peroxisome proliferator-activated receptors (PPARs) and associated transcription factors in colon cancer: reduced expression of PPARgamma-coactivator 1 (PGC-1).
14652494 2003 PGC-1alpha genotype modifies the association of volitional energy expenditure with [OV0312]O2max.
14636573 2003 Coordination of p300-mediated chromatin remodeling and TRAP/mediator function through coactivator PGC-1alpha.
14633846 2003 Endurance training in humans leads to fiber type-specific increases in levels of peroxisome proliferator-activated receptor-gamma coactivator-1 and peroxisome proliferator-activated receptor-alpha in skeletal muscle.
14574455 2003 Evidence for genetic epistasis in human insulin resistance: the combined effect of PC-1 (K121Q) and PPARgamma2 (P12A) polymorphisms.
14522988 2003 PGC-1alpha activates CYP7A1 and bile acid biosynthesis.
12972445 2004 PGC-1alpha mRNA expression is influenced by metabolic perturbation in exercising human skeletal muscle.
12866036 2003 Expression of peroxisome-proliferator activated receptor-gamma (PPARgamma) and the PPARgamma co-activator, PGC-1, in human breast cancer correlates with clinical outcomes.
12832613 2003 Coordinated reduction of genes of oxidative metabolism in humans with insulin resistance and diabetes: Potential role of PGC1 and NRF1.
12611894 2003 Upstream stimulatory factor represses the induction of carnitine palmitoyltransferase-Ibeta expression by PGC-1.
12606537 2003 A Gly482Ser missense mutation in the peroxisome proliferator-activated receptor gamma coactivator-1 is associated with altered lipid oxidation and early insulin secretion in Pima Indians.
12606503 2003 Regulation of PGC-1 promoter activity by protein kinase B and the forkhead transcription factor FKHR.
12588810 2003 Peroxisome proliferator-activated receptor-gamma coactivator 1 alpha (PGC-1 alpha): transcriptional coactivator and metabolic regulator.
12574109 2003 Peroxisome proliferator-activated receptor-gamma coactivator-1 gene locus: associations with hypertension in middle-aged men.
12565902 2003 Reduced expression of PGC-1 and insulin-signaling molecules in adipose tissue is associated with insulin resistance.
12563009 2003 Exercise induces transient transcriptional activation of the PGC-1alpha gene in human skeletal muscle.
12522104 2003 The transcriptional coactivator PGC-1 regulates the expression and activity of the orphan nuclear receptor estrogen-related receptor alpha (ERRalpha).
12502716 2003 Ligand and coactivator identity determines the requirement of the charge clamp for coactivation of the peroxisome proliferator-activated receptor gamma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12470660 2002 PGC-1 and PERC, coactivators of the estrogen receptor-related receptor gamma.
12470296 2003 Potentiation of liver X receptor transcriptional activity by peroxisome-proliferator-activated receptor gamma co-activator 1 alpha.
12397057 2002 Identification of a specific molecular repressor of the peroxisome proliferator-activated receptor gamma Coactivator-1 alpha (PGC-1alpha).
12189208 2002 Identification of a transcriptionally active peroxisome proliferator-activated receptor alpha -interacting cofactor complex in rat liver and characterization of PRIC285 as a coactivator.
12181572 2002 Transcriptional co-activator PGC-1 alpha drives the formation of slow-twitch muscle fibres.
12107756 2002 A genetic variation in the PGC-1 gene could confer insulin resistance and susceptibility to Type II diabetes.
12032643 2002 No association between the G482S polymorphism of the proliferator-activated receptor-gamma coactivator-1 (PGC-1) gene and Type II diabetes in French Caucasians.
12011097 2002 Early growth response factor-1 is a critical transcriptional mediator of peroxisome proliferator-activated receptor-gamma 1 gene expression in human aortic smooth muscle cells.
11943463 2002 Transcriptional activators and coactivators in the nuclear control of mitochondrial function in mammalian cells.
11916956 2002 Peroxisome proliferator-activated receptor-gamma coactivator-1 gene locus: associations with obesity indices in middle-aged women.
11875072 2002 Peroxisome proliferator-activated receptor (PPAR) gamma coactivator-1 recruitment regulates PPAR subtype specificity.
11854298 2002 The PGC-1-related protein PERC is a selective coactivator of estrogen receptor alpha.
11793024 2001 Mutation analysis of peroxisome proliferator-activated receptor-gamma coactivator-1 (PGC-1) and relationships of identified amino acid polymorphisms to Type II diabetes mellitus.
11788685 2002 A novel heterozygous mutation in peroxisome proliferator-activated receptor-gamma gene in a patient with familial partial lipodystrophy.
11751919 2002 Requirement of helix 1 and the AF-2 domain of the thyroid hormone receptor for coactivation by PGC-1.
11741533 2001 Cytokine stimulation of energy expenditure through p38 MAP kinase activation of PPARgamma coactivator-1.
11733490 2002 Peroxisome proliferator-activated receptor gamma coactivator 1beta (PGC-1beta ), a novel PGC-1-related transcription coactivator associated with host cell factor.
11714715 2002 PGC-1 functions as a transcriptional coactivator for the retinoid X receptors.
11557984 2001 CREB regulates hepatic gluconeogenesis through the coactivator PGC-1.
11551810 2001 PGC-1, a versatile coactivator.
11340167 2001 Pgc-1-related coactivator, a novel, serum-inducible coactivator of nuclear respiratory factor 1-dependent transcription in mammalian cells.
11158005 2001 Effect of the peroxisome proliferator-activated receptor-gamma 2 pro(12)ala variant on obesity, glucose homeostasis, and blood pressure in members of familial type 2 diabetic kindreds.
10983978 2000 Direct coupling of transcription and mRNA processing through the thermogenic coactivator PGC-1.
10748020 2000 Modulation of estrogen receptor-alpha transcriptional activity by the coactivator PGC-1.
10713165 2000 A tissue-specific coactivator of steroid receptors, identified in a functional genetic screen.
10669761 2000 The coactivator PGC-1 cooperates with peroxisome proliferator-activated receptor alpha in transcriptional control of nuclear genes encoding mitochondrial fatty acid oxidation enzymes.
10643692 1999 Cloning and mRNA tissue distribution of human PPARgamma coactivator-1.
10585775 1999 Human peroxisome proliferator activated receptor gamma coactivator 1 (PPARGC1) gene: cDNA sequence, genomic organization, chromosomal localization, and tissue expression.
10558993 1999 Activation of PPARgamma coactivator-1 through transcription factor docking.
10412986 1999 Mechanisms controlling mitochondrial biogenesis and respiration through the thermogenic coactivator PGC-1.
9529258 1998 A cold-inducible coactivator of nuclear receptors linked to adaptive thermogenesis.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
1258810 1976 Cognitive strategies and response to suggestion in hypnotic and task-motivated subjects.