Property Summary

NCBI Gene PubMed Count 1,673
PubMed Score 8950.62
PubTator Score 4693.16

Knowledge Summary

Patent (119,840)

TINX Plot

  Disease Sources (8)

Disease Target Count P-value
non-small cell lung cancer 2798 1.05872943288442E-20
lung carcinoma 2844 1.85082538496883E-17
tuberculosis 1563 1.7736943815388E-9
posterior fossa group A ependymoma 1511 2.54204105011785E-8
lung adenocarcinoma 2714 4.3566252939663E-8
lung cancer 4473 1.65008282001622E-6
interstitial cystitis 2299 3.93883128008556E-5
group 4 medulloblastoma 1875 9.19654259192151E-5
medulloblastoma, large-cell 6234 2.04543633814727E-4
pancreatic cancer 2300 2.37041591408412E-4
ductal carcinoma in situ 1745 2.50826036951153E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.72084642307583E-4
invasive ductal carcinoma 2950 3.90955879955725E-4
breast carcinoma 1614 6.07281909880031E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0014975951451488
primitive neuroectodermal tumor 3031 0.00268595016676649
Atopic dermatitis 944 0.00594547930871201
osteosarcoma 7933 0.00831199343908274
fibroadenoma 557 0.0112989390222574
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0268532558786835
esophageal adenocarcinoma 737 0.0296558049117775
mucosa-associated lymphoid tissue lymphoma 480 0.0492422509118985
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0
Type 2 diabetes mellitus 192 0.0 1.0
Disease Target Count Z-score Confidence
diabetes mellitus 1663 6.825 3.4

Expression

Synonym

Accession P37231 A8K3G6 B5BUA1 O00684 O00710 O14515 Q0QJH8 Q15178 Q15179 Q15180 Q15832 Q86U60 Q96J12 PPAR-gamma
Symbols GLM1
CIMT1
NR1C3
PPARG1
PPARG2
PPARgamma

Gene

PDB

1FM6   1FM9   1I7I   1K74   1KNU   1NYX   1PRG   1RDT   1WM0   1ZEO   1ZGY   2ATH   2F4B   2FVJ   2G0G   2G0H   2GTK   2HFP   2HWQ   2HWR   2I4J   2I4P   2I4Z   2OM9   2P4Y   2POB   2PRG   2Q59   2Q5P   2Q5S   2Q61   2Q6R   2Q6S   2Q8S   2QMV   2VSR   2VST   2VV0   2VV1   2VV2   2VV3   2VV4   2XKW   2YFE   2ZK0   2ZK1   2ZK2   2ZK3   2ZK4   2ZK5   2ZK6   2ZNO   2ZVT   3ADS   3ADT   3ADU   3ADV   3ADW   3ADX   3AN3   3AN4   3B0Q   3B0R   3B1M   3B3K   3BC5   3CDP   3CDS   3CS8   3CWD   3D6D   3DZU   3DZY   3E00   3ET0   3ET3   3FEJ   3FUR   3G9E   3GBK   3H0A   3HO0   3HOD   3IA6   3K8S   3KMG   3LMP   3NOA   3OSI   3OSW   3PBA   3PO9   3PRG   3QT0   3R5N   3R8A   3R8I   3S9S   3SZ1   3T03   3TY0   3U9Q   3V9T   3V9V   3V9Y   3VJH   3VJI   3VN2   3VSO   3VSP   3WJ4   3WJ5   3WMH   3X1H   3X1I   4A4V   4A4W   4CI5   4E4K   4E4Q   4EM9   4EMA   4F9M   4FGY   4HEE   4JAZ   4JL4   4L96   4L98   4O8F   4OJ4   4PRG   4PVU   4PWL   4R06   4R2U   4R6S   4XLD   4XTA   4XUH   4XUM   4Y29   4YT1   5AZV   5DSH   5DV3   5DV6   5DV8   5DWL   5F9B  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus EggNOG Inparanoid

  TechDev Info (1)

Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

MLP Assay (9)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504446 confirmatory 11 / 0 / 5 TR-FRET-based biochemical dose response competitive binding lanthascreen assay for partial agonists of the peroxisome proliferator-activated receptor gamma (PPARg)
504447 confirmatory 24 / 0 / 46 Luminescence-based cell-based assay provider high throughput dose response assay for partial agonists of the peroxisome proliferator-activated receptor gamma (PPARg)
504452 screening 60 / 0 / 175 Luminescence-based cell-based primary high throughput screening assay to identify partial agonists of the peroxisome proliferator-activated receptor gamma (PPARg)
504453 confirmatory 7 / 0 / 12 Fluorescence-polarization-based biochemical polarscreen dose response binding assay for partial agonists of the peroxisome proliferator-activated receptor gamma (PPARg)
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors
504939 confirmatory 6 / 0 / 2 Late stage assay provider results from the probe development effort to identify non-agonists of the peroxisome proliferator-activated receptor gamma (PPARg): Luminescence-based cell-based dose response assay to identify transactivation inhibitor of PPRE (PPARG response element)
504943 confirmatory 9 / 0 / 1 Late stage assay provider results from the probe development effort to identify non-agonists of the peroxisome proliferator-activated receptor gamma (PPARg): TR-FRET-based biochemical dose response competitive binding lanthascreen assay for non-agonists of the PPARg
540293 other 1 / 0 / 0 Late stage assay provider counterscreen results from the probe development effort to identify non-agonists of the peroxisome proliferator-activated receptor gamma (PPARg): Leptin-deficient ob/ob mouse model studies to assess the effect of probe candidate on fasting blood glucose

Gene RIF (1851)

PMID Text
27078877 our findings reveal a key role for PPARgamma in neurogenesis and in the pathophysiology of human cytomegalovirus congenital infection
26966066 We conclude that under OGD condition, PEDF and 44mer reduce H9c2 cells apoptosis and inhibit OGD-induced oxidative stress via its receptor PEDF-R and the PPARgamma signaling pathway.
26956036 PPARgamma might inhibit the proliferation and migration of GC cell lines through suppressing the expression of TERT and ENAH
26869517 These observations indicate that troglitazone not only promotes growth, also the survival of RPT cells under conditions of hypoxia.
26782582 The PPARG SNPs rs6802898 and rs12633551 were significantly associated with the prevalence of hypertension in the Han and Mongolian populations, respectively.
26775637 cPGI2 activates PPARalpha and PPARgamma, which act separately from IP-R to up-regulate the expression of key genes involved in the function of brite adipocytes.
26721185 PPAR gamma inhibits the basal and LPS-induced expression of HMGB1 through upregulation of miR-142-3p, which can target the 3'-UTR of HMGB1, by directly binding to the PPRE in the miR-142-3p promoter region.
26673968 No association was found between PPARdelta T294C single nucleotide polymorphisms with obesity and metabolic syndrome in a multi-ethnic population in Kampar, Malaysia.
26671025 PPARgamma 12Pro/Ala resulting in an amino acid exchange in N-terminal sequence may be an independent protective factor for ischemic stroke in the Chinese Han population.
26631736 PPARgamma protein was increased in umbilical cord MSCs from obese mothers compared to cord MSCs from normal weight mothers.
More...

AA Sequence

MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDF      1 - 70
SSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECR     71 - 140
VCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRF    141 - 210
GRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDM    211 - 280
NSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGV    281 - 350
HEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII    351 - 420
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETD    421 - 490
MSLHPLLQEIYKDLY                                                           491 - 505
//

Text Mined References (1687)

PMID Year Title
27078877 2016 PPAR? Is Activated during Congenital Cytomegalovirus Infection and Inhibits Neuronogenesis from Human Neural Stem Cells.
26966066 2016 PEDF and PEDF-derived peptide 44mer inhibit oxygen-glucose deprivation-induced oxidative stress through upregulating PPAR? via PEDF-R in H9c2 cells.
26956036 2016 Constitutive expression of PPAR? inhibits proliferation and migration of gastric cancer cells and down-regulates Wnt/?-Catenin signaling pathway downstream target genes TERT and ENAH.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26869517 2016 Cancer drug troglitazone stimulates the growth and response of renal cells to hypoxia inducible factors.
26782582 2015 Association of SNPs in the PPAR? gene and hypertension in a Mongolian population.
26775637 2016 IP-receptor and PPARs trigger the conversion of human white to brite adipocyte induced by carbaprostacyclin.
26721185 2016 PPAR? inhibits HMGB1 expression through upregulation of miR-142-3p in vitro and in vivo.
26673968 2015 Screening of Peroxisome Proliferator-Activated Receptors (PPARs) ?, ? and ? Gene Polymorphisms for Obesity and Metabolic Syndrome Association in the Multi-Ethnic Malaysian Population.
26671025 2016 Functional Genetic Variants of PPARx03B3; and PPAR? Encoding Peroxisome Proliferator-Activated Receptors and Susceptibility to Ischemic Stroke in Chinese Han Population.
More...