Property Summary

Ligand Count 353
NCBI Gene PubMed Count 292
PubMed Score 327.18
PubTator Score 507.40

Knowledge Summary

Patent (10,291)

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytoma 1.100 4.6e-02
intraductal papillary-mucinous carcinoma... 1.500 2.4e-03
medulloblastoma, large-cell -1.900 5.0e-06
ovarian cancer 1.500 1.4e-05
psoriasis 1.100 9.8e-03

Protein-protein Interaction (7)

PDB (40)

Gene RIF (269)

AA Sequence

MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQMGCDGASCGSL      1 - 70
NMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSH     71 - 140
NAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAP    141 - 210
FVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVT    211 - 280
LLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLAL    281 - 350
FIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI    351 - 420
KKTETETSLHPLLQEIYKDMY                                                     421 - 441
//

Text Mined References (301)

PMID Year Title