Property Summary

NCBI Gene PubMed Count 274
PubMed Score 307.39
PubTator Score 507.40

Knowledge Summary

Patent (10,291)

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.500 4.0e-64
astrocytoma 1.100 4.6e-02
medulloblastoma, large-cell -1.900 5.0e-06
intraductal papillary-mucinous carcinoma... 1.500 2.4e-03
ovarian cancer 1.500 1.4e-05

Protein-protein Interaction (8)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (253)

PMID Text
26921399 Data suggest enhancement of hepatocyte mitochondrial biogenesis and beta-oxidation by all-trans-retinoic acid requires peroxisome proliferator activated receptor delta; retinoic acid receptor alpha/beta do not appear to be involved in this response.
26915488 Polymorphism of rs2016520 in gene PPARD was associated with benign metabolic traits in a large cohort of Chinese adults
26871769 LncPPARd can be a biomarker for coronary artery disease (CAD). The regulation of LncPPARd on expression of its neighboring protein-coding gene PPARd and direct target genes PPARd, ADRP, and ANGPTL4 may be involved in CAD pathogenesis.
26673968 No association was found between PPARgamma2 C161T single nucleotide polymorphisms with obesity and metabolic syndrome in a multi-ethnic population in Kampar, Malaysia.
26613934 Essential hypertension risk is associated with SNP-SNP interactions in a Chinese population.
26481780 PPAR delta plays pivotal roles in wound healing by promoting fibroblast-to-myofibroblast differentiation via transforming growth factor-beta/Smad3 signaling.
26443862 studies identify a novel PPRE-mediated regulatory mechanism for LDLR transcription and suggest that combined treatment of statin with PPARdelta agonists may have advantageous effects on LDLR expression.
26346611 The PPARdelta+294C allele maybe an independent risk of IS in Chinese Uyghurs especially in the male and obesity populations.
26322419 Studied the role of WNT/beta-catenin signaling via the PPARdelta/p38 pathway in cigarette smoke (CS)-related airway inflammation using patient lung tissues, human bronchial epithelial cells (16HBECs), and mouse models.
26227398 It plays a role in insulin sensitivity.
26125839 The meta-analysis revealed no association between PPARD rs2016520 and coronary heart disease , suggesting ethnic differences in the association between the PPARD locus and coronary heart disease .
26098621 Evidence that multiple PPARalpha/delta/gamma gene polymorphisms are individually associated with increased low-density lipoprotein-cholesterol, and that interactions, among these alleles result in additional increased risk suggesting that PPAR genes may contribute substantially to the risk of cardiovascular diseases and atherosclerosis.
26073637 C-C haplotype of PPARD, constructed from rs2016520 and rs9794 alleles, showed a significant protective effect for both abnormal weight and abdominal obesity
26004416 In the present review, the recent progress of PPARdelta signaling-mediated colorectal cancer is covered--{REVIEW}
25986483 A PPARG variant is associated with susceptibility to SSc, consistent with a role of PPAR-gamma in the pathogenesis of SSc.
25873088 association of +294T/C polymorphism on lipid profiles on longevity in Bama, China
25857370 activation of PPAR-delta decreased VLDL receptor expression and VLDL uptake via the induction of miR-100.
25776471 These results showed that PPARD rs2016520 displayed a strong relationship with intracerebral hemorrhages risk in the male Han Chinese.
25758678 PPARs involved in the pathogenesis of migraine.
25722086 These new data indicate that 4-hydroxynonenal, generated following NADPH oxidase activation, functions as an endogenous activator of PPARalpha and PPARbeta/delta.
25311380 PPARD rs2016520 polymorphism influences the therapeutic effect of repaglinide in Chinese Han with type 2 diabetes mellitus.
25149191 PPARdelta-mediated modulation of MMP-2 secretion and elastin expression may contribute to the maintenance of skin integrity by inhibiting ROS generation
25061733 The -87T/C PPARdelta gene polymorphism is closely related to obesity, plasma lipid abnormality, insulin resistance, and TNF-alpha in individuals with type 2 diabetes in a Dalian population.
25043640 Our findings suggest that lung-cancer patients with the CC variant of PPARD rs3734254 may have a survival advantage over lung-cancer patients with other gene variants.
24987006 Peroxisome proliferator-activated receptor beta has roles in regulation of development, metabolism, and inflammation [review]
24958459 Data show that peroxisome proliferator activator receptor delta (PPARdelta/beta) directly regulates CD300a protein in macrophages.
24898257 new role for ER stress and UPR that attenuates H-RAS-induced senescence and suggest that PPARbeta/delta can repress this oncogene-induced ER stress to promote senescence in accordance with its role as a tumor modifier that suppresses carcinogenesis
24692551 Data indicate that fatty acid-binding protein 5 (FABP5) is tuned to selectively stimulate peroxisome proliferation-activated receptor beta/delta transactivation in response to specific fatty acids based on their structural features.
24610641 PPARdelta is required for hypoxic stress-mediated cytokine expression in colon cancer cells, resulting in promotion of angiogenesis, macrophage recruitment, and macrophage proliferation in the tumor microenvironment.
24527778 PPARbeta activation in vitro and in vivo restores the endothelial function, preserving the insulin-Akt-eNOS pathway impaired by high glucose, at least in part, through PDK4 activation.
24508264 Data indicate that palmitic acid induced suppression of apolipoprotein M (APOM) expression is mediated via the peroxisome proliferator-activated receptor beta/delta (PPARbeta/delta) pathway.
24391853 PPARD mutations are associated with colorectal cancer.
24252308 Results suggest that myelin-derived phosphatidylserine mediates PPAR-beat/delta activation in macrophages after myelin uptake
24118591 the PPARD A/C/C haplotype (rs2267668/rs2016520/rs1053049) was significantly underrepresented in athletes compared to controls, suggesting that the A/C/C haplotypes may influence elite athletic performance.
24107399 Pleiotropic effects of peroxisome proliferator-activated receptor gamma and delta in vascular diseases. [review]
24060638 Down-regulation of PPAR delta gene is associated with Metabolic Syndrome.
23991827 role of peroxisome proliferator-activated receptor delta (PPARdelta) activation on global gene expression and mitochondrial fuel utilization in myotube
23907334 Genetic variants of peroxisome proliferator-activated receptor delta are associated with gastric cancer.
23842279 In the presence of PPARbeta/delta, Vpr induced a 3.3-fold increase in PPAR response element-driven transcriptional activity, a 1.9-fold increase in PDK4 protein expression, and a 1.6-fold increase in the phosphorylated pyruvate dehydrogenase subunit E1alpha.
23842279 HIV-1 Vpr regulates mitochondrial respiration and enhances the activity of hydroxyacyl-CoA dehydrogenase (HADH) through PPARbeta/delta
23832539 Data show that AP1 is the transcriptional factor that contributes to peroxisome proliferator-activated receptor delta gene (PPARdelta) expression in LoVo cells.
23811234 PPARs play a role in placental nitric oxide (NO) and lipid homeostasis and can regulate NO production, lipid concentrations and lipoperoxidation in placentas from type 2 diabetic patients.
23646170 PPARbeta/delta plays a role in the assembly of a cytoplasmic multi-protein complex containing TAK1, TAB1, HSP27 and PPARbeta/delta, and thereby participates in the NFkappaB response to IL-1beta.
23639976 These results suggest that PPARdelta-mediated inhibition of MMP-1 secretion prevents some effects of photoaging.
23607100 These results suggest that PPAR delta may be a potential therapeutic target against the progression of vascular remodeling in Pulmonary arterial hypertension .
23598720 Expression of PPARdelta is tightly correlated in both prostate tissues and cell lines and significantly higher in cancer vs. normal tissues.
23545576 rs2016520 and rs10865170 were associated with lower obesity risk. In addition, interaction was identified among rs2016520, rs9794, and rs10865170 in obesity.
23525285 PPARdelta is regulated by miR-9 in monocytes.
23512374 The PPARdelta +294T/C polymorphism was associated with the risk of ischemic stroke in Tunisian subjects. No interaction between diabetes and PPAR +294T/C polymorphism on the risk of ischemic stroke was found.
23323702 These data document for the first time that the expression of BMAL1, PER3, PPARD and CRY2 genes is altered in gestational diabetes compared to normal pregnant women. deranged expression of clock genes may play a pathogenic role in GDM.
23262340 PPAR-alpha, PPAR-delta and PPAR-gamma polymorphisms may contribute to the risk of hypertriglyceridemia independently and/or in an interactive manner.
23208498 A PPARbeta/delta-ANGPTL4 pathway is involved in the regulation of tumor cell invasion.
23109900 Several lipid-related gene polymorphisms interact with overweight/obesity to modulate blood pressure levels.
23086933 beta-Catenin and peroxisome proliferator-activated receptor-delta coordinate dynamic chromatin loops for the transcription of vascular endothelial growth factor A gene in colon cancer cells
23056264 Findings suggest that fatty acids (FAs)-PPARdelta/RXR-Angptl4 axis controls the lipoprotein lipase (LPL)-dependent uptake of FAs in myotubes.
23049921 PPARbeta/delta might be a central element in lung carcinogenesis controlling multiple pathways and representing a potential target for NSCLC treatment
23023367 Activation of peroxisome proliferator-activated receptor delta inhibits human macrophage foam cell formation and the inflammatory response induced by very low-density lipoprotein.
22945906 Peroxisome proliferator-activated receptor delta agonist attenuates nicotine suppression effect on human mesenchymal stem cell-derived osteogenesis and involves increased expression of heme oxygenase-1.
22944052 The C allele in the PPARD rs2016520 genotype is significantly associated with a lower rate of abdominal obesity. There is an interaction between PPARA, PPARD and PPARG SNPs on the incidence of abdominal obesity.
22683888 the reduction in PPARbeta/delta activity and SIRT1 expression caused by TNF-alpha stimulation through NF-kappaB helps perpetuate the inflammatory process in human adipocytes.
22606221 two residues (Val312 and Ile328) in the buried hormone binding pocket play special roles in PPARdelta selective binding
22509365 common variants in PPARD contribute to the risk of type 2 diabetes in Chinese Hans, and provided suggestive evidence of interaction between 25(OH)D levels and PPARD-rs6902123 on HbA1c
22310107 Gene variants in PPARD and PPARGC1A might be associated with timing of natural menopause, probably through direct actions on the ovaries, among the general Japanese population.
22277050 Polymorphic variants of PPARD and APOE genes are associated with coronary heart disease.
22247001 relationships between polymorphisms of the ACE, ACTN3, PPARD, and PPARGC1A genes and performance as measured by six fitness tests in sedentary adolescent girls
22209682 Oleic acid activates GPR40-phospholipase C-calcium pathway to increase the expression of PPAR-delta and PPAR-delta further decreased the expression of PTEN to regulate insulin sensitivity in hepatic steatosis.
22192471 there is no interaction between the PPARD +294T > C genotypes and alcohol consumption on serum lipid levels in alcohol drinkers.
22072715 ligand-activated PPARdelta confers resistance to Ang II-induced senescence by up-regulation of PTEN and ensuing modulation of the PI3K/Akt signaling to reduce ROS generation in vascular cells.
22021335 PPAR-gamma/delta signaling accounts in part for the vasodilating effect of prostacyclins in pulmonary arteries.
21896929 investigation of function of PPARD in regulating insulin secretion in hyperglycemia (i.e., high glucose): Data indicate that an endogenous ligand of PPARD (4-hydroxy-2-nonenal) mimics glucose in stimulating insulin secretion in a beta-cell line.
21834910 No significant associations between PPARD and T2D were found in either genotyped or imputed SNPs and no effect modification between exercise participation and PPARD genetic variation was found.
21765467 PPARdelta and PPARgamma coordinately regulate cancer cell fate by controlling the balance between the cell death and survival
21750705 Data show a novel pathway involving HL hydrolysis of VLDL that activates PPARdelta through generation of specific monounsaturated fatty acids.
21696362 [review] PPARbeta/delta activation exerts beneficial effects against organ-related ischemic events, which are among the most critical cardiovascular complications evoked by metabolic dysregulation.
21531809 Increase of PPAR delta predicts favorable survival in the rectal cancer patients either with or without preoperative radiotherapy
21520069 The results support the important role of peroxisome proliferator-activated receptor beta/delta in neuronal differentiation strongly point towards peroxisome proliferator-activated receptor beta/delta as modulators of crucial pathways.
21496113 PPAR-delta agonists inhibit TGFalpha-induced MMP9 expression in human keratinocytes. This inhibition involves repression of c-fos binding at the MMP9 promoter.
21487230 Gene-diet interactions were also found for for PPARdelta -87T-->C with the polyunsaturated/saturated fat ratio .
21426320 Analysis of PPARdelta mRNA levels revealed a hypomorph expression of human PPARdelta in liver.
21400612 Expression of peroxisome proliferator-activated nuclear receptor beta/delta is lower in human and Apc(+/Min-FCCC) mouse colon tumors than in corresponding normal tissue.
21352808 these results may lead to a better understanding of the molecular mechanisms underlying the anti-senescent effect of PPARdelta.
21331343 myocyte expression of peroxisome proliferator-activated receptor delta and the adiponectin receptors 1 and 2 and T-cadherin are highly coordinated and this might be of relevance for human lipid metabolism in vivo
21283829 enabled the definition of 112 bona fide PPARbeta/delta target genes showing either of three distinct types of transcriptional response
21176135 the association of PPARD +294T > C polymorphism and serum lipid levels is different between the Bai Ku Yao and Han populations
21070867 Data describe the effects of the PPARbeta/delta agonist GW501516 on inflammation, and show that GW501516-induced PPARbeta/delta activation attenuates the inflammatory response induced in human cardiac AC16 cells exposed to palmitate and in mice fed a high-fat diet.
20855565 Observational study of gene-disease association. (HuGE Navigator)
20844743 Observational study of gene-disease association. (HuGE Navigator)
20840271 The +294T/C polymorphism in the exon 4 of the PPAR-delta gene seems to cause an increase in fasting glucose levels.
20840271 Observational study of gene-disease association. (HuGE Navigator)
20824502 The expression of both PPAR delta and COX-2 in tissues may lead to liver metastasis and consequent poor prognosis in colorectal cancer patients.
20811626 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20647061 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20645257 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20624891 PPAR-delta serves as an important molecular brake for the control of central nervous system autoimmune inflammation.
20621019 SNP and haplotypes of PPARD, PPARG and APM1 may underlie the genetic basis of the constitutions classified in traditional Chinese medicine.
20621019 Observational study of gene-disease association. (HuGE Navigator)
20595396 Genome-wide transcriptional profiling that PPARbeta/delta and transforming growth factor-beta (TGFbeta) pathways functionally interact in human myofibroblasts and that a subset of these genes is cooperatively activated by TGFbeta and PPARbeta/delta.
20592029 PPARdelta induces IL-8 expression in nonstimulated endothelial cells via transcriptional as well as posttranscriptional mechanisms
20512451 CYBA +242C/T and PPARD +294T/C variants modulate risk of coronary artery disease through their associations with atherogenic serum lipid profiles.
20512451 Observational study of gene-disease association. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20424164 Fatty acid-binding protein 5 and PPARbeta/delta are critical mediators of epidermal growth factor receptor-induced carcinoma cell growth
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20308079 ACSL3 is a novel molecular target of PPARdelta in HepG2 cells; there is a regulatory mechanism for ACSL3 transcription in liver tissue
20238044 The expression of genes involved in lipid metabolism and expression of the three isoforms of PPARs in an immortalized cell line of human retinal pigment epithelial cells, were investigated.
20221637 PPARbeta/delta as an alternative COX-independent mechanism of VEGF induction in colorectal tumor cells.
20200337 In subjects with and without type 2 diabetes, single polymorphism was associated with body mass index, high-density lipoprotein cholesterol, leptin, and TNFalpha and was dependent on gender
20200337 Observational study of gene-disease association. (HuGE Navigator)
20160399 Predominant role of PPARdelta in the transcriptional regulation of SIRT1 gene.
20045185 PPARdelta may be involved in the pathophysiology of gestational diabes, preeclampsia, and IUGR.
20044476 Observational study of gene-disease association. (HuGE Navigator)
19951549 EGF inhibits HaCaT apoptosis caused by TNF-alpha in a PPARbeta-dependent manner.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19948841 PLA2-modified LDL transactivates macrophage PPARalpha and PPARdelta, but not PPARgamma.
19935699 findings consistently indicate that PPAR-beta may facilitate differentiation and inhibit the cell-fibronectin adhesion of colon cancer.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19903700 important relationship between PPARdelta, PGC1alpha, and haem oxygenase-1, demonstrating that haem oxygenase-1 induction plays an important role in cytoprotective actions of PPARdelta ligands in vascular endothelium
19878569 Observational study of gene-disease association. (HuGE Navigator)
19863319 The majority of tumours showed strong p16, p21, p27, pRb and cyclin D1 staining and little or no p53 expression. Tumours harbouring dysplasia were significantly more likely to be p53-positive and exhibit up-regulated p21 and p27.
19838202 The data of this study show that genetic deficiency of PPAR- delays clearance of apoptotic cells and increases autoantibody production, leading to immune complex-mediated glomerulonephritis.
19818126 Observational study of gene-disease association. (HuGE Navigator)
19805479 REVIEW: current status regarding the regulation, and the metabolic effects, of PPARdelta in skeletal muscle
19756148 analysis of PPARgamma ligand modulated antagonism by genomic and non-genomic actions of PPARdelta
19723884 results establish an important role for PPAR-delta in transcription of tumor-promoting genes, which can be specifically modulated by high-affinity RNA intramers in colon cancer cells
19681917 Meta-analysis of gene-disease association and gene-gene interaction. (HuGE Navigator)
19666693 a higher frequency of the peroxisome proliferator-activated receptor gamma coactivator 1 Gly/Gly + PPARD CC genotype is associated with elite-level endurance athletes
19666693 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19653005 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19628794 Shear stress induces synthetic-to-contractile phenotypic modulation in smooth muscle cells via peroxisome proliferator-activated receptor alpha/delta activations by prostacyclin released by sheared endothelial cells.
19615407 This review focuses particularly on the emerging roles of PPARbeta/delta as an alternative regulator of inflammation and inflammation-related disorders. [review]
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19538467 PPARdelta plays an important role in skin wound healing in vivo and that it functions by accelerating extracellular matrix-mediated cellular interactions in a process mediated by the TGF-beta1/Smad3 signaling-dependent or - independent pathway.
19527689 PPARalpha and PPARbeta/delta do not appear to modulate the alternative differentiation of human macrophages.
19512923 review of evidence for role of PPAR[delta] in lipid & lipoprotein metabolism; genetic association studies of SNP's in PPARD gene have only provided negative or conflicting evidence for gross phenotypes: obesity, hyperlipidaemia & type 2 diabetes [review]
19461048 PPARdelta-induced upregulation of extracellular matrix proteins exerts an antiapoptotic effect, thereby maintaining the stability of atherosclerotic plaques
19453261 Observational study of gene-disease association. (HuGE Navigator)
19435887 PGC-1alpha-induced fatty acid oxidation and mitochondrial biogenesis appear to be independent of PPARdelta
19429679 ceramide, an important lipid component of epidermis, up-regulates ABCA12 expression via the PPARdelta-mediated signaling pathway, providing a substrate-driven, feed-forward mechanism for regulating this key lipid transporter
19395102 PPARdelta attenuated CRP-induced pro-inflammatory effects may through CD32 and NF-kappaB pathway
19383774 PPARdelta may affect height through a variety of mechanisms including altered metabolic efficiency or effects on osteoclast function.
19383774 Observational study of gene-disease association. (HuGE Navigator)
19307598 Regulation of epithelial-mesenchymal IL-1 signaling by PPARbeta/delta is essential for skin homeostasis and wound healing.
19303973 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19283612 Evaluation of PPAR gamma and delta expression is useful for predicting postoperative mortality in patients undergoing colorectal cancer surgery.
19279199 Report PPAR/RXRalpha dysregulation in preterm and infection-driven infection labor.
19208777 Observational study of gene-disease association. (HuGE Navigator)
19201410 PPARg, PPARd and LXRa are involved in the regulation of ABCA1 expression and HDL biogenesis in a cooperative signal transduction pathway
19157507 Peroxisome proliferator-activated receptor expression in effusions from ovarian carcinomais associated with poor response to chemotherapy at disease recurrence and poor survival
19074989 ANGPTL4 is produced by human myotubes in response to long chain fatty acids and is of systemic relevance in humans.
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19056929 although acting through a ligand-dependent modality, PPARdelta is a negative regulator of VD-mediated monocyte differentiation
18937948 Hydrogen peroxide down-regulated the expression/activation of PPAR-beta, which played important roles in hydrogen peroxide-induced apoptosis in endothelial cells.
18797401 Observational study of gene-disease association. (HuGE Navigator)
18797151 lower transactivity of PPAR delta for arachidonic acid in Caco-2 cells, compared with PPAR alpha, is associated with the binding activity of p300 to the receptor
18720000 The simultaneous expression of peroxisome proliferator-activated receptor delta and cyclooxygenase-2 may enhance angiogenesis and tumor venous invasion in tissues of colorectal cancers.
18701481 up-regulation of peroxisome proliferator-activated receptor-delta is associated with thyroid tumors
18676870 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18657264 We have found significant interaction between CAPN5 and PPARD genes that reduces risk for obesity in 55%. CAPN5 and PPARD gene products may also interact in vivo.
18627005 Novel mechanism by which PPARdelta regulates lipogenesis, suggesting potential therapeutic applications of PPARdelta modulators in obesity and type 2 diabetes, as well as related steatotic liver diseases.
18625220 These results demonstrate that epidermal growth factor induces PPARbeta/delta expression in a c-Jun-dependent manner and PPARbeta/delta plays a vital role in EGF-stimulated proliferation of HaCaT cells.
18606951 PPARD gene is associated with bipolar disorder
18606951 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18566335 PPARbeta/delta is strongly expressed in the majority of lung cancers, and its activation induces proliferative and survival response in non-small cell lung cancer.
18511850 activation of COX-1/PGI(2)/PPARdelta pathway is an important mechanism underlying proangiogenic function of EPCs.
18438697 Observational study of gene-disease association. (HuGE Navigator)
18388689 polymorphisms in peroxisome proliferator-activated receptors are critical susceptibility risk factors for dyslipidemias and diabetes [review]
18379566 No significant effects of PPAR delta T+294C polymorphism or the interaction of the PPAR delta and PPAR gamma variants on adiposity-related phenotypes were observed in any age group or gender
18379566 Observational study of gene-disease association. (HuGE Navigator)
18337509 PPARdelta antagonizes multiple proinflammatory pathways
18305567 There is a direct link between type 1 IFN signaling and PPARdelta. The induction of PPARdelta by type 1 IFN contributes to the persistence of activated T cells in psoriasis skin lesions.
18288282 Observational study of gene-disease association. (HuGE Navigator)
18252792 SNPs rs1053049, rs6902123, and rs2267668 in PPARD affect life style intervention-induced changes in overall adiposity, hepatic fat storage, and relative muscle mass.
18252792 Observational study of gene-disease association. (HuGE Navigator)
18240567 PPARD C allele is associated with predisposition to endurance performance.
18182682 review of role of activation of PPARalpha, -beta/delta, or -gamma or LXRs in skin physiology and cytology and disease
18048767 ligand activation of PPAR-delta (peroxisome proliferator-activated receptor delta ) in Endothelial cells has an antiinflammatory effect, perhaps via a binary mechanism involving the induction of antioxidative genes and the release of nuclear corepressors
18037904 ternary complex consisting of PPARdelta, p65/RelA, and HDAC1 in keratinocytes PPARdelta repression
18024853 PPARdelta agonist GW501516 reverses multiple abnormalities associated with the metabolic syndrome without increasing oxidative stress.
17926914 Observational study of gene-disease association. (HuGE Navigator)
17855759 This study provides evidence that mRNA expression of PPARdelta in human skeletal muscle is under genetic control but also influenced by factors such as age, birth weight and central adiposity.
17724132 Metabolism of endocannabinoids by the endothelial cell COX-2 coupled to the prostacyclin (PGI(2)) synthase activates the nuclear receptor peroxisomal proliferator-activated receptor delta, which negatively regulates the expression of tissue factor.
17705821 Alternative splicing of PPARD was studied in terms of translation efficiency and trans-activation ability.
17693664 PPARbeta/delta ligands do not potentiate tumorigenesis.
17669420 PDK2, PDK3 and PDK4 are primary PPARbeta/delta target genes in humans underlining the importance of the receptor in the control of metabolism
17618585 High expression of PPARbeta may be related with the differentiation and metastasis of epithelial ovarian carcinoma.
17436029 In contrast to the PPARalpha, PPARdelta receptor isoforms were not activated by the epoxyalcohol.
17431579 Observational study of gene-disease association. (HuGE Navigator)
17431579 PPAED does not significantly affect the risk of metabolic disease in the population studied, such as type 2 diabetes.
17409576 New target for Metablic syndrome:PPARD.
17356846 REVIEW: PPARbeta/delta is a transcriptional regulator of FA uptake and oxidation, mitochondrial respiration uncoupling, and glucose metabolism
17355643 Observational study of genotype prevalence. (HuGE Navigator)
17327385 Observational study of gene-disease association. (HuGE Navigator)
17327385 the minor serine-encoding allele of the Gly482Ser single-nucleotide polymorphism in PPARGC1A was associated with less increase in individual anaerobic threshold during lifestyle intervention
17324937 analysis of the ligand-dependent control of peroxisome proliferator-activated receptor delta activity
17322100 The activated proinflammatory state of monocytes and MDM in low HDL-C subjects constitutes a novel parameter of risk associated with HDL deficiency, related to altered expression of metallothionein genes and the reciprocal regulation of PPARdelta.
17303761 PPAR delta activates 14-3-3 epsilon gene (YWHAE) promoter in human endothelial cells in a concentration and time-dependent manner.
17303142 human aortic smooth muscle cells Prostacyclin 2 synthase(PGIS) gene transfer reduced peroxisome proliferator-activated receptor delta(PPAR-delta) expression and inhibited neointimal formation after balloon injury
17294733 The expression of PPARdelta gene in rectal cancers is not statistically different from that in normal mucosa, and it is not correlated with cell differentiation, pathological categories and Dukes stages.
17272748 Observational study of gene-disease association. (HuGE Navigator)
17259439 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17259439 DNA sequence variation in the PPARdelta locus is a potential modifier of changes in cardiorespiratory fitness and plasma HDL-C in healthy individuals in response to regular exercise.
17254750 These studies demonstrate that ligand activation of PPARbeta/delta does not lead to an anti-apoptotic effect in either human or mouse keratinocytes, but rather, leads to inhibition of cell growth likely through the induction of terminal differentiation.
17178883 PPARdelta induces COX-2 expression and the COX-2-derived PGE(2) further activates PPARdelta via cPLA(2)alpha. which forms a growth-promoting signaling that may play a role in hepatocarcinogenesis.
17148604 support the rationale for developing PPARdelta antagonists for prevention and/or treatment of cancer
17119917 PPAR-delta activation increases cholesterol export and represses inflammatory gene expression in macrophages and atherosclerotic lesions.
17116180 Observational study of gene-disease association. (HuGE Navigator)
17116180 PPARD-87T/C polymorphism is associated with higher fasting plasma glucose concentrations in both normal glucose tolerant and diabetic subjects, largely due to impaired insulin sensitivity
17068288 PPARbeta/delta is a novel regulator of endothelial cell proliferation and angiogenesis through VEGF.
16979821 Observational study of gene-disease association. (HuGE Navigator)
16953259 Observational study of gene-disease association. (HuGE Navigator)
16906219 Observational study of gene-disease association. (HuGE Navigator)
16897074 Therefore, these results indicate that induction of fatty acid oxidation with PPARbeta activators during short-term exposition is not sufficient to correct for insulin resistance in muscle cells from type 2 diabetic patients.
16804087 Observational study of gene-disease association. (HuGE Navigator)
16804087 Single nucleotide polymorphisms in PPARD modify the conversion from glucose intolerance to type 2 diabetes.
16752430 Skeletal muscle mRNA expression of PPAR delta increased in type 2 diabetic patients with an improved clinical profile following low-intensity exercise, but were unchanged in patients who did not show exercise-mediated improvements in clinical parameters.
16652134 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16652134 data provide further evidence for an involvement of PPARdelta in the regulation of BMI.
16645156 PGI2 protects endothelial cells from H2O2-induced apoptosis by inducing PPARdelta binding to 14-3-3alpha promoter, thereby upregulating 14-3-3alpha protein expression.
16511591 This review concludes that PPAR delta has emerged as a powerful metabolic regulator in diverse tissues including fat, skeletal muscle, and the heart.
16476973 overexpressed during the S phase of the cell cycle compared with the G0/1 phase
16387648 Data describe the activated form of the peroxisome proliferator-activated receptor-beta/delta using a ligand binding domain model.
16368717 Human platelets contain PPARbeta and that its selective activation inhibits platelet aggregation.
16361076 The expression of PPARdelta gene in rectal cancers is not statistically different from normal mucosa.
16344721 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16306381 Observational study of gene-disease association. (HuGE Navigator)
16306381 Single nucleotide polymorphisms of PPARD primarily affected insulin sensitivity by modifying glucose uptake in skeletal muscle but not in adipose tissue.
16285997 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16285997 PPARdelta +294T/C polymorphism has no influence on plasma lipoprotein concentrations, body mass index or atherosclerotic disease either in healthy subjects or in patients with DM-2, both in males and females.
16141797 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16091736 PPARdelta partially rescued prostate epithelial cells from growth inhibition and also dramatically inhibited sulindac sulfide-mediated p21WAF1/CIP1 upregulation.
16053787 PPARdelta + 294T/C gene polymorphism in subjects with metabolic syndrome may be involved in the occurrence of obesity and dyslipidemia.
15979543 PPARdelta expression is up-regulated between the first and third trimester, indicating a role for this nuclear receptor in placental function
15890193 PPARdelta signaling pathways are interconnected at the level of cross-regulation of their respective transcription factor mRNA levels
15888456 the ligand-independent tight control of the position of the PPAR helix 12 provides an effective alternative for establishing an interaction with CoA proteins
15811118 COX-2 immunopositivity was significantly associated with PPARbeta and PPARgamma immunoreactivity. Microvessel density was significantly higher among PPARbeta-immunoreactive squamous cell carcinomas.
15793256 This study was performed to determine whether specific activation of PPARdelta has direct effects on insulin action in skeletal muscle.
15591138 11beta-HSD2 is an additional target for PPAR delta, which may regulate human placental function
15128052 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15102088 PPAR-beta/delta activation stimulates keratinocyte differentiation, is anti-inflammatory, improves barrier homeostasis, and stimulates triglyceride accumulation in keratinocytes.
15001550 gene regulation by PPARdelta in the uterine cells uniquely responds to SRC-2, N-CoR, SMRT, or RIP140, and these interactions may be operative during implantation when these cofactors are abundantly expressed.
14988273 Observational study of gene-disease association. (HuGE Navigator)
14988273 Positive associations of PPAR-delta polymorphisms with fasting plasma glucose and BMI detected in nondiabetic control subjects
14758356 results implicate PPAR-delta in the regulation of intestinal adenoma growth
14641801 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12909723 The 15-lipoxygenase-1 product 13-S-hydroxyoctadecadienoic acid down-regulates PPAR-delta to induce apoptosis in colorectal cancer cells.
12615676 4 polymorphisms were found: -409C/T (promoter, +73C/T (exon 1), +255A/G (exon 3), & +294T/C (exon 4). An interaction with the PPAR alpha L162V polymorphism was also detected for several lipid parameters. PPARD plays a role in cholesterol metabolism.
12594814 Expression of peroxisome proliferator-activated receptors (PPARs) in human urinary bladder carcinoma and growth inhibition by its agonists.
12009300 Results suggest that peroxisome proliferator-activated receptor beta overexpression is not an inherent property of breast cancer cell lines, but it may play a role through activation of downstream genes (PPARbeta).
11980898 differential regulation of vascular endothelial growth factor expression in bladder cancer cells (peroxisome proliferative activated receptor, beta)

AA Sequence

MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQMGCDGASCGSL      1 - 70
NMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSH     71 - 140
NAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAP    141 - 210
FVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVT    211 - 280
LLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLAL    281 - 350
FIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI    351 - 420
KKTETETSLHPLLQEIYKDMY                                                     421 - 441
//

Text Mined References (283)

PMID Year Title
26921399 2016 All-Trans-Retinoic Acid Enhances Mitochondrial Function in Models of Human Liver.
26915488 2016 PPARD rs2016520 polymorphism is associated with metabolic traits in a large population of Chinese adults.
26871769 2016 Circulating "LncPPAR?" From Monocytes as a Novel Biomarker for Coronary Artery Diseases.
26673968 2015 Screening of Peroxisome Proliferator-Activated Receptors (PPARs) ?, ? and ? Gene Polymorphisms for Obesity and Metabolic Syndrome Association in the Multi-Ethnic Malaysian Population.
26613934 2016 Case-control study on association of peroxisome proliferator-activated receptor-? and SNP-SNP interactions with essential hypertension in Chinese Han population.
26504087 2015 Reactive Oxygen Species (ROS) Mediate p300-dependent STAT1 Protein Interaction with Peroxisome Proliferator-activated Receptor (PPAR)-? in CD36 Protein Expression and Foam Cell Formation.
26481780 2015 Ligand-activated PPAR? upregulates ?-smooth muscle actin expression in human dermal fibroblasts: A potential role for PPAR? in wound healing.
26443862 2015 A novel peroxisome proliferator response element modulates hepatic low-density lipoprotein receptor gene transcription in response to PPAR? activation.
26346611 2015 Association of functional genetic variants in PPAR? encoding peroxisome proliferator-activated receptor delta with ischemic stroke in Chinese Uyghur population.
26322419 2016 WNT/?-catenin signaling regulates cigarette smoke-induced airway inflammation via the PPAR?/p38 pathway.
26227398 2015 Cinnamaldehyde Contributes to Insulin Sensitivity by Activating PPAR?, PPAR?, and RXR.
26125839 2015 Positive association between PPARD rs2016520 polymorphism and coronary heart disease in a Han Chinese population.
26098621 2015 Association and interaction of PPAR?, ?, and ? gene polymorphisms with low-density lipoprotein-cholesterol in a Chinese Han population.
26073637 2016 A population association study of PPAR ? gene rs2016520 and rs9794 polymorphisms and haplotypes with body mass index and waist circumference in a Chinese population.
26004416 2015 PPAR? signaling regulates colorectal cancer.
25986483 2015 A candidate gene study reveals association between a variant of the Peroxisome Proliferator-Activated Receptor Gamma (PPAR-?) gene and systemic sclerosis.
25873088 2015 PPARD +294C overrepresentation in general and long-lived population in China Bama longevity area and unique relationships between PPARD +294T/C polymorphism and serum lipid profiles.
25857370 2015 Activation of PPAR-? induces microRNA-100 and decreases the uptake of very low-density lipoprotein in endothelial cells.
25776471 2015 PPARD rs2016520 polymorphism and circulating lipid levels connect with brain diseases in Han Chinese and suggest sex-dependent effects.
25758678 2015 Changes in plasma PPARs levels in migraine patients.
25722086 2015 High-glucose-increased expression and activation of NADPH oxidase in human vascular smooth muscle cells is mediated by 4-hydroxynonenal-activated PPAR? and PPAR?/?.
25416956 2014 A proteome-scale map of the human interactome network.
25311380 2015 PPARD rs2016520 polymorphism affects repaglinide response in Chinese Han patients with type 2 diabetes mellitus.
25149191 2014 Peroxisome proliferator-activated receptor ? modulates MMP-2 secretion and elastin expression in human dermal fibroblasts exposed to ultraviolet B radiation.
25061733 2014 Association of peroxisome proliferator-activated receptor-delta polymorphisms with sugar metabolism indices and tumor necrosis factor alpha level.
25043640 2014 Polymorphisms of peroxisome proliferator-activated receptors and survival of lung cancer and upper aero-digestive tract cancers.
24987006 2014 Physiological functions of peroxisome proliferator-activated receptor ?.
24958459 2014 PPAR?/? activation of CD300a controls intestinal immunity.
24898257 2014 The nuclear receptor peroxisome proliferator-activated receptor-?/? (PPAR?/?) promotes oncogene-induced cellular senescence through repression of endoplasmic reticulum stress.
24692551 2014 Structural basis for ligand regulation of the fatty acid-binding protein 5, peroxisome proliferator-activated receptor ?/? (FABP5-PPAR?/?) signaling pathway.
24610641 2014 PPAR? deficiency disrupts hypoxia-mediated tumorigenic potential of colon cancer cells.
24527778 2014 PPAR? activation restores the high glucose-induced impairment of insulin signalling in endothelial cells.
24508264 2014 Palmitic acid suppresses apolipoprotein M gene expression via the pathway of PPAR?/? in HepG2 cells.
24391853 2013 Variants of the PPARD gene and their clinicopathological significance in colorectal cancer.
24252308 2013 Myelin alters the inflammatory phenotype of macrophages by activating PPARs.
24118591 2014 Genomic haplotype within the Peroxisome Proliferator-Activated Receptor Delta (PPARD) gene is associated with elite athletic status.
24107399 2013 Pleiotropic effects of peroxisome proliferator-activated receptor ? and ? in vascular diseases.
24060638 2013 Nuclear receptors expression chart in peripheral blood mononuclear cells identifies patients with Metabolic Syndrome.
23991827 2014 PPAR? activation in human myotubes increases mitochondrial fatty acid oxidative capacity and reduces glucose utilization by a switch in substrate preference.
23907334 2013 Genetic variants of peroxisome proliferator-activated receptor ? are associated with gastric cancer.
23842279 2013 HIV-1 Vpr enhances PPAR?/?-mediated transcription, increases PDK4 expression, and reduces PDC activity.
23832539 2013 Transcription factor AP1 binds the functional region of the promoter and regulates gene expression of human PPARdelta in LoVo cell.
23811234 2013 PPAR activation as a regulator of lipid metabolism, nitric oxide production and lipid peroxidation in the placenta from type 2 diabetic patients.
23646170 2013 Regulation of TAK1/TAB1-mediated IL-1? signaling by cytoplasmic PPAR?/?.
23639976 2013 PPAR? inhibits UVB-induced secretion of MMP-1 through MKP-7-mediated suppression of JNK signaling.
23607100 2013 PPAR? agonist GW501516 inhibits PDGF-stimulated pulmonary arterial smooth muscle cell function related to pathological vascular remodeling.
23598720 2013 PPAR? promotes oncogenic redirection of TGF-?1 signaling through the activation of the ABCA1-Cav1 pathway.
23545576 2013 Association of peroxisome proliferator-activated receptor ?/?/? with obesity, and gene-gene interaction, in the Chinese Han population.
23525285 2013 MicroRNA-9 regulates the expression of peroxisome proliferator-activated receptor ? in human monocytes during the inflammatory response.
23512374 2013 Effect of genetic polymorphism +294T/C in peroxisome proliferator-activated receptor delta on the risk of ischemic stroke in a Tunisian population.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23323702 2013 Circadian clock gene expression is impaired in gestational diabetes mellitus.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23262340 2013 Gene-gene interactions among PPAR?/?/? polymorphisms for hypertriglyceridemia in Chinese Han population.
23208498 2013 Inverse PPAR?/? agonists suppress oncogenic signaling to the ANGPTL4 gene and inhibit cancer cell invasion.
23137000 Novel susceptibility genes associated with diabetic cataract in a Taiwanese population.
23109900 2012 Several lipid-related gene polymorphisms interact with overweight/obesity to modulate blood pressure levels.
23086933 2012 ?-Catenin and peroxisome proliferator-activated receptor-? coordinate dynamic chromatin loops for the transcription of vascular endothelial growth factor A gene in colon cancer cells.
23056264 2012 Angiopoietin-like 4 mediates PPAR delta effect on lipoprotein lipase-dependent fatty acid uptake but not on beta-oxidation in myotubes.
23049921 2012 Transcriptional and Non-Transcriptional Functions of PPAR?/? in Non-Small Cell Lung Cancer.
23023367 2012 Activation of peroxisome proliferator-activated receptor ? inhibits human macrophage foam cell formation and the inflammatory response induced by very low-density lipoprotein.
22945906 2013 Peroxisome proliferator-activated receptor delta agonist attenuates nicotine suppression effect on human mesenchymal stem cell-derived osteogenesis and involves increased expression of heme oxygenase-1.
22944052 2012 [Effects of PPARD-87T > C and interactions with single nucleotide polymorphisms in PPARA and PPARG on abdominal obesity].
22683888 2012 TNF-? inhibits PPAR?/? activity and SIRT1 expression through NF-?B in human adipocytes.
22606221 2012 Structural insights into human peroxisome proliferator activated receptor delta (PPAR-delta) selective ligand binding.
22509365 2012 Associations of type 2 diabetes with common variants in PPARD and the modifying effect of vitamin D among middle-aged and elderly Chinese.
22310107 2012 Gene variants in PPARD and PPARGC1A are associated with timing of natural menopause in the general Japanese population.
22277050 2012 Investigation of polymorphic variants of PPARD and APOE genes in Turkish coronary heart disease patients.
22247001 2012 ACE I/D, ACTN3 R577X, PPARD T294C and PPARGC1A Gly482Ser polymorphisms and physical fitness in Taiwanese late adolescent girls.
22209682 2012 Oleic acid activates peroxisome proliferator-activated receptor ? to compensate insulin resistance in steatotic cells.
22192471 2011 The peroxisome proliferator-activated receptor delta +294T > C polymorphism and alcohol consumption on serum lipid levels.
22072715 2011 PPAR? coordinates angiotensin II-induced senescence in vascular smooth muscle cells through PTEN-mediated inhibition of superoxide generation.
22021335 2012 Peroxisome proliferator-activated receptor-?/?, the acute signaling factor in prostacyclin-induced pulmonary vasodilation.
21998595 2011 Identification, replication, and fine-mapping of Loci associated with adult height in individuals of african ancestry.
21896929 2011 Role of lipid peroxidation and PPAR-? in amplifying glucose-stimulated insulin secretion.
21834910 2011 Peroxisome proliferator-activated receptor delta (PPARD) genetic variation and type 2 diabetes in middle-aged Chinese women.
21765467 2012 Peroxisome proliferator-activated receptor ? confers resistance to peroxisome proliferator-activated receptor ?-induced apoptosis in colorectal cancer cells.
21750705 2011 VLDL hydrolysis by hepatic lipase regulates PPAR? transcriptional responses.
21696362 2011 The role of PPAR?/? in the management of metabolic syndrome and its associated cardiovascular complications.
21531809 2011 Biological function and prognostic significance of peroxisome proliferator-activated receptor ? in rectal cancer.
21520069 2011 Signal transduction pathways involved in PPAR?/?-induced neuronal differentiation.
21496113 2011 AP1-dependent repression of TGF?-mediated MMP9 upregulation by PPAR? agonists in keratinocytes.
21487230 2011 Effects of peroxisome proliferator-activated receptors, dietary fat intakes and gene-diet interactions on peak particle diameters of low-density lipoproteins.
21426320 2011 Generation and characterization of a humanized PPAR? mouse model.
21400612 2011 Functional characterization of peroxisome proliferator-activated receptor-?/? expression in colon cancer.
21352808 2011 Transcriptional up-regulation of antioxidant genes by PPAR? inhibits angiotensin II-induced premature senescence in vascular smooth muscle cells.
21331343 2011 The myocyte expression of adiponectin receptors and PPAR? is highly coordinated and reflects lipid metabolism of the human donors.
21283829 2011 Genomewide analyses define different modes of transcriptional regulation by peroxisome proliferator-activated receptor-?/? (PPAR?/?).
21176135 2010 Peroxisome proliferator-activated receptor delta +294T > C polymorphism and serum lipid levels in the Guangxi Bai Ku Yao and Han populations.
21070867 2011 PPAR?/? activation blocks lipid-induced inflammatory pathways in mouse heart and human cardiac cells.
20855565 2010 Common genetic variation in multiple metabolic pathways influences susceptibility to low HDL-cholesterol and coronary heart disease.
20844743 2010 Single nucleotide polymorphisms in the Wnt and BMP pathways and colorectal cancer risk in a Spanish cohort.
20840271 2010 Peroxisome proliferator-activated receptor-? and -? polymorphisms in women with polycystic ovary syndrome.
20824502 2011 The expression of both peroxisome proliferator-activated receptor delta and cyclooxygenase-2 in tissues is associated with poor prognosis in colorectal cancer patients.
20811626 2010 Genetic variants in inflammation-related genes are associated with radiation-induced toxicity following treatment for non-small cell lung cancer.
20647061 2011 Mitochondrial biogenesis related endurance genotype score and sports performance in athletes.
20645257 2010 +294T/C polymorphism in the PPAR-delta gene is associated with risk of coronary artery disease in normolipidemic Tunisians.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20624891 2010 Peroxisome proliferator-activated receptor delta limits the expansion of pathogenic Th cells during central nervous system autoimmunity.
20621019 2010 Polymorphisms in PPARD, PPARG and APM1 associated with four types of traditional Chinese medicine constitutions.
20595396 2010 Transcriptional profiling identifies functional interactions of TGF ? and PPAR ?/? signaling: synergistic induction of ANGPTL4 transcription.
20592029 2010 Peroxisome proliferator-activated receptor {delta} activators induce IL-8 expression in nonstimulated endothelial cells in a transcriptional and posttranscriptional manner.
20512451 2010 Association of the CYBA, PPARGC1A, PPARG3, and PPARD gene variants with coronary artery disease and metabolic risk factors of coronary atherosclerosis in a Russian population.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20424164 2010 Fatty acid-binding protein 5 and PPARbeta/delta are critical mediators of epidermal growth factor receptor-induced carcinoma cell growth.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20308079 2010 Long chain acyl-CoA synthetase-3 is a molecular target for peroxisome proliferator-activated receptor delta in HepG2 hepatoma cells.
20238044 2010 PPAR nuclear receptors and altered RPE lipid metabolism in age-related macular degeneration.
20221637 2011 Peroxisome-proliferator-activated receptors ? and ?/? mediate vascular endothelial growth factor production in colorectal tumor cells.
20200337 2010 Peroxisome proliferator-activated receptor-delta genotype influences metabolic phenotype and may influence lipid response to statin therapy in humans: a genetics of diabetes audit and research Tayside study.
20195266 2011 Genomewide pharmacogenomic study of metabolic side effects to antipsychotic drugs.
20160399 2010 PPARbeta/delta regulates the human SIRT1 gene transcription via Sp1.
20045185 2010 Peroxisome proliferator-activated receptors are altered in pathologies of the human placenta: gestational diabetes mellitus, intrauterine growth restriction and preeclampsia.
20044476 2010 Associations of polymorphisms of eight muscle- or metabolism-related genes with performance in Mount Olympus marathon runners.
19951549 2009 [Role of peroxisome proliferator-activated receptor beta in the inhibitory effect of epidermal growth factor on apoptosis of HaCaT].
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19948841 2010 Phospholipase A2-modified low-density lipoprotein activates macrophage peroxisome proliferator-activated receptors.
19935699 2010 Knockdown of peroxisome proliferator-activated receptor-beta induces less differentiation and enhances cell-fibronectin adhesion of colon cancer cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19903700 2010 PPARdelta and PGC1alpha act cooperatively to induce haem oxygenase-1 and enhance vascular endothelial cell resistance to stress.
19878569 2009 Candidate genetic analysis of plasma high-density lipoprotein-cholesterol and severity of coronary atherosclerosis.
19863319 2009 Expression of p53, p16INK4A, pRb, p21WAF1/CIP1, p27KIP1, cyclin D1, Ki-67 and HPV DNA in sinonasal endophytic Schneiderian (inverted) papilloma.
19838202 2009 PPAR-delta senses and orchestrates clearance of apoptotic cells to promote tolerance.
19818126 2009 Single nucleotide polymorphisms in obesity-related genes and all-cause and cause-specific mortality: a prospective cohort study.
19805479 2009 Regulation of skeletal muscle physiology and metabolism by peroxisome proliferator-activated receptor delta.
19756148 2009 Ligand modulated antagonism of PPARgamma by genomic and non-genomic actions of PPARdelta.
19723884 2009 Modulation of transcription by the peroxisome proliferator-activated receptor delta--binding RNA aptamer in colon cancer cells.
19681917 2010 The role of genetic variation in peroxisome proliferator-activated receptors in the polycystic ovary syndrome (PCOS): an original case-control study followed by systematic review and meta-analysis of existing evidence.
19666693 2009 Is there an interaction between PPARD T294C and PPARGC1A Gly482Ser polymorphisms and human endurance performance?
19653005 2009 The combined impact of metabolic gene polymorphisms on elite endurance athlete status and related phenotypes.
19628794 2009 Shear stress induces synthetic-to-contractile phenotypic modulation in smooth muscle cells via peroxisome proliferator-activated receptor alpha/delta activations by prostacyclin released by sheared endothelial cells.
19622862 2009 Adaptability and selectivity of human peroxisome proliferator-activated receptor (PPAR) pan agonists revealed from crystal structures.
19615407 2009 Emerging roles of peroxisome proliferator-activated receptor-beta/delta in inflammation.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19538467 2010 PPARdelta promotes wound healing by up-regulating TGF-beta1-dependent or -independent expression of extracellular matrix proteins.
19527689 2009 Unlike PPARgamma, PPARalpha or PPARbeta/delta activation does not promote human monocyte differentiation toward alternative macrophages.
19512923 2009 PPARdelta in humans: genetic and pharmacological evidence for a significant metabolic function.
19464171 2009 Identification of a PPARdelta agonist with partial agonistic activity on PPARgamma.
19461048 2009 Peroxisome proliferator-activated receptor {delta} regulates extracellular matrix and apoptosis of vascular smooth muscle cells through the activation of transforming growth factor-{beta}1/Smad3.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19435887 2009 PPAR{delta} agonism activates fatty acid oxidation via PGC-1{alpha} but does not increase mitochondrial gene expression and function.
19429679 2009 Ceramide stimulates ABCA12 expression via peroxisome proliferator-activated receptor {delta} in human keratinocytes.
19395102 2010 Comparison of PPAR? and PPAR? in inhibiting the pro-inflammatory effects of C-reactive protein in endothelial cells.
19383774 2009 A single nucleotide polymorphism on exon-4 of the gene encoding PPARdelta is associated with reduced height in adults and children.
19307598 2009 Regulation of epithelial-mesenchymal IL-1 signaling by PPARbeta/delta is essential for skin homeostasis and wound healing.
19303973 2009 RARRES2, encoding the novel adipokine chemerin, is a genetic determinant of disproportionate regional body fat distribution: a comparative magnetic resonance imaging study.
19283612 Influence of tumor peroxisome proliferator-activated receptor gamma and delta expression on postoperative mortality of patients undergoing colorectal cancer surgery.
19279199 2009 Preterm and infection-driven preterm labor: the role of peroxisome proliferator-activated receptors and retinoid X receptor.
19208777 2009 Genetic variation in the ADIPOR2 gene is associated with liver fat content and its surrogate markers in three independent cohorts.
19201410 2009 On the mechanism for PPAR agonists to enhance ABCA1 gene expression.
19157507 2009 Expression of the peroxisome proliferator-activated receptors-alpha, -beta, and -gamma in ovarian carcinoma effusions is associated with poor chemoresponse and shorter survival.
19116277 2009 Scaffold-based discovery of indeglitazar, a PPAR pan-active anti-diabetic agent.
19074989 2009 Muscle-derived angiopoietin-like protein 4 is induced by fatty acids via peroxisome proliferator-activated receptor (PPAR)-delta and is of metabolic relevance in humans.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19056929 2009 PPARdelta is a ligand-dependent negative regulator of vitamin D3-induced monocyte differentiation.
18937948 2009 Role of PPAR-beta in hydrogen peroxide-induced apoptosis in human umbilical vein endothelial cells.
18797401 2008 The PPARD gene may be associated with schizophrenia in a Chinese population.
18797151 2008 PPAR alpha and PPAR delta transactivity and p300 binding activity induced by arachidonic acid in colorectal cancer cell line Caco-2.
18722772 2008 Discovery of a novel class of PPARdelta partial agonists.
18720000 2009 The simultaneous expression of peroxisome proliferator-activated receptor delta and cyclooxygenase-2 may enhance angiogenesis and tumor venous invasion in tissues of colorectal cancers.
18701481 2008 Peroxisome proliferator-activated receptor-delta induces cell proliferation by a cyclin E1-dependent mechanism and is up-regulated in thyroid tumors.
18676870 2008 Variants in inflammation genes and the risk of biliary tract cancers and stones: a population-based study in China.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18657264 2008 Interaction between Calpain 5, Peroxisome proliferator-activated receptor-gamma and Peroxisome proliferator-activated receptor-delta genes: a polygenic approach to obesity.
18627005 2008 Peroxisome proliferator-activated receptor-delta induces insulin-induced gene-1 and suppresses hepatic lipogenesis in obese diabetic mice.
18625220 2008 The role of peroxisome proliferator-activated receptor-beta/delta in epidermal growth factor-induced HaCaT cell proliferation.
18619963 2008 DNA-binding profiling of human hormone nuclear receptors via fluorescence correlation spectroscopy in a cell-free system.
18606951 2008 Association study of Wnt signaling pathway genes in bipolar disorder.
18566335 2008 Peroxisome proliferator-activated receptor beta/delta expression and activation in lung cancer.
18511850 2008 Angiogenic function of prostacyclin biosynthesis in human endothelial progenitor cells.
18438697 2008 Genetic study between SIRT1, PPARD, PGC-1alpha genes and Alzheimer's disease.
18388689 2008 Single gene contributions: genetic variants of peroxisome proliferator-activated receptor (isoforms alpha, beta/delta and gamma) and mechanisms of dyslipidemias.
18379566 2008 Impact of peroxisome proliferator-activated receptors gamma and delta on adiposity in toddlers and preschoolers in the GENESIS Study.
18337509 2008 PPARdelta regulates multiple proinflammatory pathways to suppress atherosclerosis.
18305567 2008 PPARdelta is a type 1 IFN target gene and inhibits apoptosis in T cells.
18288282 2008 Genetic polymorphisms of peroxisome proliferator-activated receptors and the risk of cardiovascular morbidity and mortality in a community-based cohort in washington county, Maryland.
18252792 2008 Variations in PPARD determine the change in body composition during lifestyle intervention: a whole-body magnetic resonance study.
18240567 [Association of PPARD gene polymorphism with human physical performance].
18182682 2008 Thematic review series: skin lipids. Peroxisome proliferator-activated receptors and liver X receptors in epidermal biology.
18048767 2008 Suppression of pro-inflammatory adhesion molecules by PPAR-delta in human vascular endothelial cells.
18037904 2008 HDAC activity is required for p65/RelA-dependent repression of PPARdelta-mediated transactivation in human keratinocytes.
18024853 2008 Activation of peroxisome proliferator-activated receptor (PPAR)delta promotes reversal of multiple metabolic abnormalities, reduces oxidative stress, and increases fatty acid oxidation in moderately obese men.
17926914 2007 [Association of regulatory genes polymorphisms with aerobic and anaerobic performance of athletes].
17855759 2007 Regulation of skeletal muscle PPAR delta mRNA expression in twins.
17724132 2007 COX-2 suppresses tissue factor expression via endocannabinoid-directed PPARdelta activation.
17705821 2007 Alternative splicing of human peroxisome proliferator-activated receptor delta (PPAR delta): effects on translation efficiency and trans-activation ability.
17693664 2007 Peroxisome proliferator-activated receptor-beta/delta (PPARbeta/delta) ligands do not potentiate growth of human cancer cell lines.
17669420 2007 Three members of the human pyruvate dehydrogenase kinase gene family are direct targets of the peroxisome proliferator-activated receptor beta/delta.
17618585 2007 [The relation of peroxisome proliferator activated receptorbeta and Epithelial Ovarian Carcinoma].
17560785 2007 Design of a partial PPARdelta agonist.
17436029 2007 Epidermal lipoxygenase products of the hepoxilin pathway selectively activate the nuclear receptor PPARalpha.
17431579 2007 Variation in the peroxisome proliferator-activated receptor delta gene in relation to common metabolic traits in 7,495 middle-aged white people.
17409576 2007 New therapeutic target for metabolic syndrome: PPARdelta.
17356846 2007 Roles of PPARs on regulating myocardial energy and lipid homeostasis.
17355643 2007 Frequencies of single nucleotide polymorphisms in genes regulating inflammatory responses in a community-based population.
17327385 2007 Genetic variations in PPARD and PPARGC1A determine mitochondrial function and change in aerobic physical fitness and insulin sensitivity during lifestyle intervention.
17324937 2007 Block of nuclear receptor ubiquitination. A mechanism of ligand-dependent control of peroxisome proliferator-activated receptor delta activity.
17322100 2007 Predominance of a proinflammatory phenotype in monocyte-derived macrophages from subjects with low plasma HDL-cholesterol.
17303761 2007 Peroxisome proliferator-activated receptor-delta upregulates 14-3-3 epsilon in human endothelial cells via CCAAT/enhancer binding protein-beta.
17303142 2007 Prostacyclin synthase gene transfer inhibits neointimal formation by suppressing PPAR delta expression.
17294733 2007 [Quantification of PPARdelta mRNA by real-time RT-PCR in rectal cancer tissues].
17272748 2007 High frequency of a retinoid X receptor gamma gene variant in familial combined hyperlipidemia that associates with atherogenic dyslipidemia.
17259439 2007 Peroxisome proliferator-activated receptor-delta polymorphisms are associated with physical performance and plasma lipids: the HERITAGE Family Study.
17254750 2007 Ligand activation of peroxisome proliferator-activated receptor-beta/delta(PPARbeta/delta) inhibits cell growth of human N/TERT-1 keratinocytes.
17178883 2006 Cross-talk between peroxisome proliferator-activated receptor delta and cytosolic phospholipase A(2)alpha/cyclooxygenase-2/prostaglandin E(2) signaling pathways in human hepatocellular carcinoma cells.
17148604 2006 Crosstalk between peroxisome proliferator-activated receptor delta and VEGF stimulates cancer progression.
17119917 2007 Peroxisome proliferator-activated receptor-delta, a regulator of oxidative capacity, fuel switching and cholesterol transport.
17116180 2006 Peroxisome proliferator-activated receptor (PPAR) delta genetic polymorphism and its association with insulin resistance index and fasting plasma glucose concentrations in Chinese subjects.
17068288 2007 Activation of PPARbeta/delta induces endothelial cell proliferation and angiogenesis.
16979821 2006 PPARD haplotype influences cholesterol metabolism but is no risk factor of Alzheimer's disease.
16953259 2007 Features of the metabolic syndrome are modulated by an interaction between the peroxisome proliferator-activated receptor-delta -87T>C polymorphism and dietary fat in French-Canadians.
16931011 2006 3,4,5-Trisubstituted isoxazoles as novel PPARdelta agonists. Part 2.
16906219 2006 Association of the T+294C polymorphism in PPAR delta with low HDL cholesterol and coronary heart disease risk in women.
16897074 2006 Short-term activation of peroxysome proliferator-activated receptor beta/delta increases fatty acid oxidation but does not restore insulin action in muscle cells from type 2 diabetic patients.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16804087 2006 Single nucleotide polymorphisms of PPARD in combination with the Gly482Ser substitution of PGC-1A and the Pro12Ala substitution of PPARG2 predict the conversion from impaired glucose tolerance to type 2 diabetes: the STOP-NIDDM trial.
16752430 Low-intensity exercise increases skeletal muscle protein expression of PPARdelta and UCP3 in type 2 diabetic patients.
16652134 2006 Association of peroxisome proliferator-activated receptor delta +294T/C with body mass index and interaction with peroxisome proliferator-activated receptor alpha L162V.
16645156 2006 Protection of endothelial survival by peroxisome proliferator-activated receptor-delta mediated 14-3-3 upregulation.
16511591 2006 PPAR delta: a dagger in the heart of the metabolic syndrome.
16476973 2006 Identifying cellular genes crucial for the reactivation of Kaposi's sarcoma-associated herpesvirus latency.
16405912 2006 Recombinant human PPAR-beta/delta ligand-binding domain is locked in an activated conformation by endogenous fatty acids.
16387648 2006 Reevaluation of the PPAR-beta/delta ligand binding domain model reveals why it exhibits the activated form.
16368717 2006 Role of nuclear receptor signaling in platelets: antithrombotic effects of PPARbeta.
16361076 2006 Quantitative analysis of PPARdelta mRNA by real-time RT-PCR in 86 rectal cancer tissues.
16344721 2006 Protective effect of nonsteroidal anti-inflammatory drugs on colorectal adenomas is modified by a polymorphism in peroxisome proliferator-activated receptor delta.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16306381 2005 Single nucleotide polymorphisms in the peroxisome proliferator-activated receptor delta gene are associated with skeletal muscle glucose uptake.
16285997 2005 The peroxisome proliferator-activated receptor delta +294T/C polymorphism in relation to lipoprotein metabolism in patients with diabetes mellitus type 2 and in non-diabetic controls.
16141797 2005 No evidence that polymorphisms in CYP2C8, CYP2C9, UGT1A6, PPARdelta and PPARgamma act as modifiers of the protective effect of regular NSAID use on the risk of colorectal carcinoma.
16091736 2005 Both PPARgamma and PPARdelta influence sulindac sulfide-mediated p21WAF1/CIP1 upregulation in a human prostate epithelial cell line.
16053787 2005 [PPARdelta + 294T/C gene polymorphism related to plasma lipid, obesity and left ventricular hypertrophy in subjects with metabolic syndrome].
15979543 2005 Human placental peroxisome proliferator-activated receptor delta and gamma expression in healthy pregnancy and in preeclampsia and intrauterine growth restriction.
15890193 2005 The human peroxisome proliferator-activated receptor delta gene is a primary target of 1alpha,25-dihydroxyvitamin D3 and its nuclear receptor.
15888456 2005 Structural determinants of the agonist-independent association of human peroxisome proliferator-activated receptors with coactivators.
15811118 2005 Peroxisome proliferator-activated receptors in squamous cell carcinoma and its precursors.
15803109 2005 PPAR delta: an uncompletely known nuclear receptor.
15793256 2005 Direct activation of glucose transport in primary human myotubes after activation of peroxisome proliferator-activated receptor delta.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
15604518 2005 Reduced cholesterol absorption upon PPARdelta activation coincides with decreased intestinal expression of NPC1L1.
15591138 2005 Peroxisome proliferator-activated receptor delta suppresses 11beta-hydroxysteroid dehydrogenase type 2 gene expression in human placental trophoblast cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15192438 2004 Roles of peroxisome proliferator-activated receptor delta in skeletal muscle function and adaptation.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15128052 2004 Effects of PPARalpha, gamma and delta haplotypes on plasma levels of lipids, severity and progression of coronary atherosclerosis and response to statin therapy in the lipoprotein coronary atherosclerosis study.
15102088 2004 Peroxisome proliferator-activated receptor (PPAR)-beta/delta stimulates differentiation and lipid accumulation in keratinocytes.
15001550 2004 Transcriptional cofactors exhibit differential preference toward peroxisome proliferator-activated receptors alpha and delta in uterine cells.
14988273 2004 Genetic polymorphisms in peroxisome proliferator-activated receptor delta associated with obesity.
14758356 2004 Activation of nuclear hormone receptor peroxisome proliferator-activated receptor-delta accelerates intestinal adenoma growth.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14641801 2003 Peroxisome proliferator activated receptor delta genotype in relation to cardiovascular risk factors and risk of coronary heart disease in hypercholesterolaemic men.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12970571 2003 Transcriptional repression of atherogenic inflammation: modulation by PPARdelta.
12955147 2003 Oleylethanolamide regulates feeding and body weight through activation of the nuclear receptor PPAR-alpha.
12934104 2003 Enhancement of BRCA1 gene expression by the peroxisome proliferator-activated receptor gamma in the MCF-7 breast cancer cell line.
12909723 2003 The 15-lipoxygenase-1 product 13-S-hydroxyoctadecadienoic acid down-regulates PPAR-delta to induce apoptosis in colorectal cancer cells.
12615676 2003 Evidence that peroxisome proliferator-activated receptor delta influences cholesterol metabolism in men.
12594814 2003 Expression of peroxisome proliferator-activated receptors (PPARs) in human urinary bladder carcinoma and growth inhibition by its agonists.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12009300 2002 Peroxisome proliferator-activated receptor beta expression in human breast epithelial cell lines of tumorigenic and non-tumorigenic origin.
11980898 2002 Differential regulation of vascular endothelial growth factor expression by peroxisome proliferator-activated receptors in bladder cancer cells.
11867749 2002 The peroxisome proliferator-activated receptor delta, an integrator of transcriptional repression and nuclear receptor signaling.
11847022 2002 [PPARdelta and PPARgamma: roles in fatty acids signalling, implication in tumorigenesis].
11551955 2001 Prostacyclin-dependent apoptosis mediated by PPAR delta.
11226285 2001 Genetic disruption of PPARdelta decreases the tumorigenicity of human colon cancer cells.
10991946 2000 Alterations of peroxisome proliferator-activated receptor delta activity affect fatty acid-controlled adipose differentiation.
10872826 2000 Gadd45 family proteins are coactivators of nuclear hormone receptors.
10866668 2000 Growth, adipose, brain, and skin alterations resulting from targeted disruption of the mouse peroxisome proliferator-activated receptor beta(delta).
10851270 2000 Characterization of the human peroxisome proliferator activated receptor delta gene and its expression.
10839530 2000 Roles of PPARs in health and disease.
10809235 2000 Alteration of a single amino acid in peroxisome proliferator-activated receptor-alpha (PPAR alpha) generates a PPAR delta phenotype.
10567538 1999 Biochemical analysis of distinct activation functions in p300 that enhance transcription initiation with chromatin templates.
10555149 1999 PPARdelta is an APC-regulated target of nonsteroidal anti-inflammatory drugs.
10198642 1999 Molecular recognition of fatty acids by peroxisome proliferator-activated receptors.
9647638 1998 Physical map of human 6p21.2-6p21.3: region flanking the centromeric end of the major histocompatibility complex.
9113987 1997 Fatty acids and eicosanoids regulate gene expression through direct interactions with peroxisome proliferator-activated receptors alpha and gamma.
8910358 1996 Cloning and identification of rat deoxyuridine triphosphatase as an inhibitor of peroxisome proliferator-activated receptor alpha.
8812511 1996 Assignment of the human nuclear hormone receptor, NUC1 (PPARD), to chromosome 6p21.1-p21.2.
7876127 1995 The human peroxisome proliferator-activated receptor (PPAR) subtype NUC1 represses the activation of hPPAR alpha and thyroid hormone receptors.
1333051 1992 Identification of a new member of the steroid hormone receptor superfamily that is activated by a peroxisome proliferator and fatty acids.