Property Summary

NCBI Gene PubMed Count 38
PubMed Score 691.21
PubTator Score 433.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
adult high grade glioma 3801 1.7e-04
psoriasis 6694 1.8e-04
Multiple myeloma 1332 4.1e-04
diabetes mellitus 1728 3.2e-03
colon cancer 1478 2.2e-02
ovarian cancer 8520 3.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Baylisascariasis 4 4.184 2.1

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.100 1.7e-04
colon cancer 1.600 2.2e-02
diabetes mellitus -1.100 3.2e-03
Multiple myeloma 1.917 4.1e-04
ovarian cancer 1.300 3.0e-02
psoriasis 1.100 1.8e-04

Gene RIF (18)

AA Sequence

MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIK      1 - 70
QDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKV     71 - 140
LGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEF    141 - 210
KDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDV    211 - 280
DKWFHHQKN                                                                 281 - 289
//

Text Mined References (46)

PMID Year Title