Property Summary

NCBI Gene PubMed Count 33
PubMed Score 654.08
PubTator Score 433.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
adult high grade glioma 2148 1.7e-04
psoriasis 6685 1.8e-04
Multiple myeloma 1327 4.1e-04
diabetes mellitus 1663 3.2e-03
colon cancer 1475 2.2e-02
ovarian cancer 8491 3.0e-02
Disease Target Count Z-score Confidence
Baylisascariasis 4 4.285 2.1

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.917 4.1e-04
psoriasis 1.100 1.8e-04
colon cancer 1.600 2.2e-02
diabetes mellitus -1.100 3.2e-03
adult high grade glioma -1.100 1.7e-04
ovarian cancer 1.300 3.0e-02

Gene RIF (13)

PMID Text
26869028 The Newcastle disease virus-induced translation shutoff at late infection times was attributed to sustaining phosphorylation of eIF2a, which is mediated by continual activation of PKR and degradation of PP1.
26722435 PPA1 may serve as a potential biomarker of poor prognosis in patients with gastric cancer
26378044 PP-1 and Akt have roles in AR-v7 protein expression and activities when AR is functionally blocked
25028520 findings indicate that brain PP-1I associates with and is regulated by the associated protein kinases C-TAK1 and PFTK1
25011106 Measles virus binding to DC-SIGN leads to inhibition of PP1 phosphatase activity and hence inhibition of RIG-I and Mda5 dephosphorylation.
25011105 The human PP1 interaction with the measles V protein is mediated by a conserved PP1-binding motif in the C-terminal region of the V protein.
23718219 PPP1R42 regulation of PP1 function in centrosome separation.
23215877 Results identify PP1 as a novel regulator of Cl(-)-HCO3(-) anion exchangers activity which, in concert with CFTR, coordinates events at both apical and basolateral membranes, crucial for efficient HCO3(-) secretion from Calu-3 cells.
22797819 Pyrophosphatase overexpression is associated with invasion, metastasis and recurrence in gastric cancer
21514157 PP1gamma is the major histone H3 phosphatase acting on the mitotically phosphorylated residues H3T3ph, H3S10ph, H3T11ph, and H3S28ph.
21317537 IRBIT opposes the effects of WNKs and SPAK by recruiting PP1 to the complex to dephosphorylate CFTR and NBCe1-B, restoring their cell surface expression, in addition to stimulating their activities
20206270 Data are consistent with the postsynaptic gephyrin scaffold acting as a platform for protein phosphatase 1 (PP1), which regulates gephyrin cluster size by dephosphorylation of gephyrin- or cytoskeleton-associated proteins.
17494625 Neither human hexokinase-1 nor human inorganic pyrophosphatase expression segregated concordantly with human cytoplasmic glutamic-oxaloacetic transaminase expression.

AA Sequence

MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIK      1 - 70
QDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKV     71 - 140
LGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEF    141 - 210
KDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDV    211 - 280
DKWFHHQKN                                                                 281 - 289
//

Text Mined References (41)

PMID Year Title
26869028 2016 Regulation of de novo translation of host cells by manipulation of PERK/PKR and GADD34-PP1 activity during Newcastle disease virus infection.
26722435 2015 Inorganic pyrophosphatase (PPA1) is a negative prognostic marker for human gastric cancer.
26378044 2015 AR-v7 protein expression is regulated by protein kinase and phosphatase.
25028520 2014 Regulation of protein phosphatase 1I by Cdc25C-associated kinase 1 (C-TAK1) and PFTAIRE protein kinase.
25011106 2014 Measles virus suppresses RIG-I-like receptor activation in dendritic cells via DC-SIGN-mediated inhibition of PP1 phosphatases.
25011105 2014 Antagonism of the phosphatase PP1 by the measles virus V protein is required for innate immune escape of MDA5.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23718219 2013 PPP1R42, a PP1 binding protein, regulates centrosome dynamics in ARPE-19 cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23215877 2013 Protein phosphatase 1 coordinates CFTR-dependent airway epithelial HCO3- secretion by reciprocal regulation of apical and basolateral membrane Cl(-)-HCO3- exchangers.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22797819 2012 Pyrophosphatase overexpression is associated with cell migration, invasion, and poor prognosis in gastric cancer.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21514157 2011 PP1/Repo-man dephosphorylates mitotic histone H3 at T3 and regulates chromosomal aurora B targeting.
21317537 2011 IRBIT governs epithelial secretion in mice by antagonizing the WNK/SPAK kinase pathway.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20206270 2010 Regulation of postsynaptic gephyrin cluster size by protein phosphatase 1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17494625 1976 Localization of the structural genes for hexokinase-1 and inorganic pyrophosphatase on region (pter-->q24) of human chromosome 10.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16583711 2006 [Identification of the proteins interacting with neuroprotective peptide humanin in a yeast two-hybrid system].
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10733883 2000 High-throughput assay for inorganic pyrophosphatases using the cytosolic enzymes of Saccharomyces cerevisiae and human as an example.
10576771 1999 Co-localization of neuroendocrine hormones in the human fetal pancreas.
10542310 1999 Cloning and expression profile of human inorganic pyrophosphatase.
6146563 1984 A de novo case of trisomy 10p: gene dosage studies of hexokinase, inorganic pyrophosphatase and adenosine kinase.
6120771 1981 Subcellular localization and properties of alkaline inorganic pyrophosphatase in human polymorphonuclear leucocytes.
6118133 1980 Secretion, subcellular localization and metabolic status of inorganic pyrophosphate in human platelets. A major constituent of the amine-storing granules.
6022858 1967 Purification and some properties of inorganic pyrophosphatase from human erythrocytes.
4130389 1974 Studies on human erythrocyte inorganic pyrophosphatase.
975879 1976 Assignment of the inorganic pyrophosphatase gene locus (PP) to chromosome 10 in man.
656444 1978 Purification and kinetic properties of human erythrocyte Mg2+-dependent inorganic pyrophosphatase.