Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.81
PubTator Score 0.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Breast cancer 3578 4.1e-04

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer -1.400 4.1e-04

AA Sequence

MAGHRPSNHFCPLPGSGGGGPRGPMPLRVDTLTWLSTQAAPGRVMVWPAVRPGICPGPDVWRIPLGPLPH      1 - 70
EFRGWIAPCRPRLGASEAGDWLRRPSEGALPGPYIALRSIPKLPPPEDISGILKELQQLAKELRQKRLSL     71 - 140
GYSQADVGIAVGALFGKVLSQTTICRFEAQQLSVANMWKLRPLLKKWLKEVEAENLLGLCKMEMILQQSG    141 - 210
KWRRASRERRIGNSLEKFFQRCPKPTPQQISHIAGCLQLQKDVVRVWFYNRSKMGSRPTNDASPREIVGT    211 - 280
AGPPCPGAPVCFHLGLGLPVDIPHYTRLYSAGVAHSSAPATTLGLLRF                          281 - 328
//

Text Mined References (5)

PMID Year Title