Property Summary

NCBI Gene PubMed Count 28
PubMed Score 7.47
PubTator Score 13.71

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

AA Sequence

MAGHLASDFAFSPPPGGGGDGPWGAEPGWVDPLTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYELC      1 - 70
GGMAYCGPQVGVGLVPQGGLETSQPESEAGVGVESNSNGASPEPCTVPPGAVKLEKEKLEQNPEKSQDIK     71 - 140
ALQKELEQFAKLLKQKRITLGYTQADVGLILGVLFGKVFSQKTICRFEALQLSFKNMCKLRPLLQKWVEE    141 - 210
ADNNENLQEICKAETLMQARKRKRTSIENRVRGNLENLFLQCPKPTLQISHIAQQLGLEKDVVRVWFCNR    211 - 280
RQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPPAPGPHFGTPGYGSPHFTALYSSVPFPEGEVFPPVSVI    281 - 350
TLGSPMHSN                                                                 351 - 359
//

Text Mined References (30)

PMID Year Title