Property Summary

NCBI Gene PubMed Count 436
PubMed Score 1980.81
PubTator Score 1751.19

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (9)

Gene RIF (384)

PMID Text
27067776 Higher OCT4 expression represents a clinically relevant predictor of patient prognosis in prostate cancer
26996130 Oct4 plays a pivotal role in the maintenance of lung CSCs resistant to gefitinib in EGFR mutation-positive non-small cell lung cancer
26992828 Sox2 and Oct4 function as molecular rheostats and utilize negative feedback loops to carefully balance their expression and other critical genes during embryogenesis. (Review)
26940070 The promoter activity of Nanog and Oct4 were upregulated, and beta-catenin was observed to bind to these promoters during H. pylori infection, while a Wnt/beta-catenin inhibitor suppressed promoter activity and binding.
26927547 Data show that octamer-binding protein-4 (Oct4) cDNA was cloned and its protein was successfully expressed in E.coli and HEK293T cells.
26824036 These findings indicate that potentially functional polymorphisms in POU5F1 gene may contribute to lung cancer susceptibility in a Chinese population.
26769970 The level of Oct4 repression was dependent on the level of GCNF expression in a dose-dependent manner.
26706028 OCT4 overexpression and loss of SOX2 expression are strongly associated with poor prognosis in patients with cervical cancer.
26654770 Several novel and known AKT phosphorylation sites are identified within OCT4, SOX2 and KLF4.
26639784 GLUT3 and OCT4 expression were correlated suggesting that Human embryonic stem cells self-renewal is regulated by the rate of glucose uptake.
26562475 the efficacy and reliability in utilizing Oct4 to isolate and characterize liver tumor propagating cells, is reported.
26507003 Low-frequency functional variant in POU5F1 may contribute to the risk of congenital heart malformations.
26483189 Oct3/4 and Nanog represent probable CSC markers in HNSCC, which contribute to the development of DNM in part by enhancing cell motility and invasiveness.
26426078 ZIC2 acts upstream of OCT4 and recruits the nuclear remodeling factor complex to the OCT4 promoter, initiating OCT4 activation. OCT4 levels positively correlated to the clinicopathological stages of HCC patients.
26417682 DPF2 decreases monomeric and mono-ubiquitinated OCT4, assembles poly-ubiquitin chains on OCT4 mainly through Ub-K48 linkage
26411902 Knockdown of OCT4 during differentiation inhibits mesendoderm formation and removal of the H3K27me3 mark from the SOX17 promoter, suggesting that OCT4 acts to induce removal of the Polycomb2 complex.
26398480 the results demonstrated for the first time that OCT4B1 functions as an oncogene in colon cancer and provides the development of novel therapeutic strategies to treat colon cancer, particularly drug resistance
26339387 SOX-2, but not Oct4, is highly expressed in early-stage endometrial adenocarcinoma and is related to tumour grading.
26260289 This data highlights a crucial role for Oct4A in the progression and metastasis of EOC. Targeting Oct4A may prove to be an effective strategy in the treatment and management of epithelial ovarian tumours.
26230571 ectopic expression of human Oct4 leads to temporal changes in multilineage differentiation of human Mesenchymal Stem Cells (hMSCs) and may inhibit neuronal differentiation of hMSCs.
26202933 showed that OAC1 treatment led to OCT4-mediated upregulation of HOXB4
26152287 patients with OCT4 high expression have significantly shorter overall survival (OS) than those without OCT4 high expression (P = 0.048). These findings suggest that OCT4 high expression is a common event and may have an adverse impact on prognosis in AML.
26125892 S100P expression in prostate cancer tissue was significantly decreased, whereas CD147 and OCT4 expression was increased. Their expression levels were closely associated with TNM stage and distant metastasis.
26102294 OCT4A induction following DNA damage in PA-1 cells, performs a cell stress, rather than self-renewal, function by moderating the expression of p21Cip1, which alongside AMPK helps to then regulate autophagy.
26013162 In hepatocellular carcinoma cells, OCT4 overexpression promoted cancer stem-like phenotypes.
25921273 Induction of neural crest genes by beta-catenin is repressed by SMAD2/SMAD3, ensuring proper lineage specification.
25911324 work reveals that OCT4 is an essential mediator in FSH-induced EMT and invasion in epithelial ovarian cancer and may act as a potential therapeutic target
25907774 expression of OCT4, SOX2, KLF4 and MYC (OSKM) induced pluripotent stem cell differentiation
25880909 functional interplay between MYCN, NCYM, and OCT4 contributes to aggressiveness of MYCN-amplified human neuroblastomas.
25879771 We illustrate that coexpression of Oct4 and Nanog initiates stem cell characteristics in hepatocellular carcinoma and promotes epithelial-mesenchymal transition
25858147 Lin28B(high)-Let7(low) expression pattern was highly correlated with high levels of ARID3B, HMGA2, OCT4, and SOX2 expression in OSCC specimens. Results show how Lin28B/Let7 regulates key cancer stem-like properties in oral squamous cancers.
25826722 Prolonged proteasome inhibition cyclically upregulates gene expression of Oct3/4 and Nanog, but reduces colony formation in the presence of the iPSC induction cocktail.
25816351 differential expression of OCT4 isoforms in cervical carcinoma
25815323 luteolin and apigenin increased telomerase activity, maintained DPCs in a presenescent state, and activated the expression of Oct-4, Sox2, and c-Myc at a dose- and time-dependent pattern in DPCs even at late passages, albeit repressed differentiation
25754111 YAP1 regulates OCT4 activity and SOX2 expression to facilitate self-renewal of stem-like cell
25664710 This is the first report of the association between early Crohn's disease and the POU5F1 single nucleotide polymorphisms.
25644290 Oct-3/4 signaling modulates the drug-resistant phenotype of glioblastoma cells through expression of ABCG2.
25634023 OCT4-pg5 can act as an RNA sponge to protect OCT4 transcripts from being inhibited by miR-145, providing novel insight into the control of OCT4 expression.
25625591 Oct4 levels in the U87 glioblastoma neurosphere cells much higher than in the monolayer parental cells, and the PI3KAkt pathway was upregulated. Aktmediated phosphorylation of Oct4A was associated with proliferation of stemlike cancer cells.
25609695 lung cancer patients with Oct4 high, PTEN low and TNC high expression profile significantly correlated with poor disease-free survival
25603874 MiRNAs regulate expression of OCT4, NANOG, SOX2 and KLF4 in cancer cells. [Review]
25564572 The concurrent expression of OCT4/NANOG/IGFIR was mostly confined to hepatitis B virus (HBV)-related HCC (HBV-HCC) and was significantly correlated with early tumor recurrence.
25474420 these findings demonstrate for the first time that CRISPR-Cas9 can be used to modify OCT4 and highlight the feasibility of creating cell-type specific reporter hESC lines utilizing genome-editing tools that facilitate homologous recombination.
25474139 CIP2A is an Oct4 target gene involved in head and neck squamous cell cancer oncogenicity and radioresistance
25464862 Different simple and complex decoys against Nanog, OCT-4, Sox2, and Klf4 were designed and used for this purpose. The results showed that the applied decoys especially Nanog-specific decoy decreased the expression of downstream genes.
25422984 Oct4A plays a critical role in regulation of cell proliferation, pluripotency, and multilineage differentiation potential of dental pulp cells.
25420671 Octamer-binding protein 4 affects the cell biology and phenotypic transition of lung cancer cells involving beta-catenin/E-cadherin complex degradation
25405855 Reduced tumorigenicity and drug resistance through the downregulation of octamer-binding protein 4 and Nanog transcriptional factor expression in human breast stem cells
25355676 Nuclear actin activates human transcription factor genes including the OCT4 gene
25355160 These findings bring OCT4 as an important target for cancer treatment, especially those resistant to chemotherapy.
25353179 These results suggest that a combined OCT4 expression/VM could improve the prognostic judgment for breast cancer patients.
25328136 The reprogramming transcription factors Oct4 and Sox2 induce glioblastoma cells to become stem-like and tumor-propagating via a mechanism involving direct DNA methyl transferase.
25324523 data demonstrate an unexpected nontranscriptional function of Oct4 in the regulation of mitotic entry.
25322154 The expression profile of Oct4 and Nanog in dental pulp cells, which exerted properties of mesenchymal stem cells was significantly up-regulated compared to that of STRO-1-CD146- dental pulp cells.
25301732 Oct-4 overexpression is associated with epithelial-mesenchymal transition of breast cancer stem cells.
25223935 Data suggest that combination of genetic variants of Oct-4 Transcription Factor, Nanog homeobox protein, and transcription factor SOX-2 gene may have a profound effect in breast cancer risk and response to neo-adjuvant chemotherapy.
25175567 OCT-4A expression was significantly increased in the BM nucleated cells of patients with acute leukemia, indicating that OCT-4A may play an important role in the pathogenesis of leukemia
25175483 Enhanced expression of ABCG2 and OCT4 in the recurrent PCa tissues postulates the suggestion that enrichment for cells with stem cell characteristics in these tissues might be playing a critical role for chemoresistance and recurrence of cancer.
25174942 The GFP gene carried by the lentivirus was successfully expressed in hUCMSCs and had no significant effect on Oct4 expression.
25128069 OCT4 is the upstream factor that directly binds to the CCND1 promoter to regulate CCND1 expression, then to promote cell cycle progression and accelerate the proliferation and invasion of esophageal cancer cells
25124662 Over-expressing Oct4 and Sox2 induced production of neural marker PGP9.5, as well as transformation of hUCB-MCs into micro-glial and endothelial lines in ALS spinal cords
25057990 Gene networks of fully connected triads (Oct4-SOX2-NANOG) with complete autoactivation enable multistability and stepwise stochastic transitions in cell differentiation fates.
25037576 HMGA2 and Oct4 expression was significantly higher in gastric cancer tissues compared with non-cancerous tissues.Coexpression of HMGA2 and Oct4 in gastric cancer correlated with tumor invasion, metastasis, and predicted an unfavorable clinical outcome.
25017645 Knockdown of OCT4 suppresses the growth and invasion of pancreatic cancer cells through inhibition of AKT pathway-mediated PCNA and MMP-2 expression, suggesting that OCT4 might serve as a potential therapeutic target for the treatment of pancreatic cancer
25008565 the expression of more than 54 apoptotic genes (64 % of arrayed genes) showed significant changes following OCT4B1 suppression in tumor cell lines
24983502 PEA3 regulates OCT4 gene expression as a transcriptional activator
24971534 ESE-1 actS as an upstream effector to regulate OCT4 transcription in NCCIT pluripotent embryonic carcinoma cells.
24966958 Embryonic stem cell biomarkers Sox2/Oct4 and Wnt signal pathway/beta-catenin are activated in cervical squamous cell carcinoma.
24954502 Data show that ectopic expression of Oct4 promotes tumor growth, increases chemoresistance and enhances tumor invasion suggesting that Oct4 may be a critical regulator of head and neck squamous carcinoma cancer stem cells.
24945968 Studied if improving OCT4 abundance can facilitate oocyte-mediated reprogramming in cloned porcine embryos, we artificially increased OCT4 levels by co-incubating donor cells with 50 ng/microl OCT4 plasmid.
24944491 Oct4 was not detected in liver cancer stem cells.
24934529 This review features of core transcription factors Oct4, Sox2 and Nanog and their role in embryogenesis and tumorigenesis including the Cancer stem cell hypothesis.
24871033 Wnt/beta-catenin signalling regulates the self-renewal of head and neck squamous cell carcinoma (HNSCC) cells with stem cell characteristics and this phenomenon occurs partly through direct Oct4 regulation by beta-catenin.
24870750 In esophageal squamous cell carcinoma, Oct4 expression was higher in poorly differentiated and basaloid subtypes than in better differentiated tumors. Oct4 was expressed by adjoining mucosa showing low grade dysplasia and basal cell hyperplasia.
24859837 miR-335 might inhibit progression and stem cell properties of pancreatic cancer targeting OCT4
24845530 Authors conclude that the Oct4-hrluc RG system enables noninvasive Oct4 imaging in cell culture and in living subjects.
24740884 Our study provides a working definition of human skin derived fibroblasts -induced plasticity using OCT4 and a deconvoluted system to elucidate the process of direct cell fate reprogramming
24700702 The positive correlation among Oct-4, Nanog, and beta-catenin suggests their coordinated role in maintaining proliferation in oral carcinoma cells.
24694094 Direct conversion of adult human fibroblasts to neural progenitor cells through the use of a single factor OCT4.
24627557 high levels of OCT4A increase hESC cloning efficiency and do not induce differentiation (whereas OCT4B expression cannot be induced in hESC
24607276 In Oct4-expressing cancer stem cells, chemopreventive action is related to growth inhibition and p38 MAPK/caspase-3 dependent pathway.
24581739 POU5F1 has an expressed retrogene which is associated with prostate cancer susceptibility
24568633 OCT4 transcriptional activity is usually dampened by its associated HDACs in cells and can be derepressed by NaB by impairing the interaction between Oct4 and HDACs
24532469 Oct-4 expression was associated with biological behavior and was an independent prognostic factor in cervical cancer.
24497960 Data suggest that nickel and cobalt may exert their reproductive toxicity through perturbing transcription Factor Oct-4 (OCT4) activity in the stem cell compartment.
24481676 we concluded that OCT3/4 and SOX2 play a critical role in the transformation of Barrett's esophagus to esophagus adenocarcinoma
24481450 PKM2-Oct4 interaction controls glioma cell death and differentiation.
24475251 Oct4 mediates tumor initiating properties in oral squamous cell carcinomas through the regulation of epithelial-mesenchymal transition.
24457968 MiR-34a directly targeted OCT4 by binding to the 3' untranslated region (3'-UTR) of OCT4 and, OCT4, in turn, stimulated p63 but inhibited p53 expression to promote human cell transformation.
24450601 study found that ALDH1, CD44, OCT4 and SOX2 are overexpressed in tongue squamous cell carcinoma
24427323 Oct4+Sox2+ profile may contribute to the malignant transformation of oral mucosa
24413464 A ligand-receptor complex SCRG1/BST1 axis facilitate mesenchymal stem cells migration, preserve OCT4 and CD271 expression, self-renewal and osteogenic differentiation.
24387977 Oct-4(A) plays a pivotal role in the detection of cancer cells with enhanced chemoresistance and provide evidence for the existence of cancer stem-like cells in head and neck squamous cell cancer
24386189 POU5F1 enhances the invasiveness of cancer stem-like cells in lung adenocarcinoma by upregulation of MMP-2 expression.
24373696 Oct-4 expression in the spinal cord coincided with presence of dividing neuroepithelial cells in the ventricular and neuroblasts in the intermediate
24370212 Oct4 is an essential regulator of opposing cell state transitions, such as pluripotency establishment and differentiation into embryonic germ lineages. [Review]
24336974 The results demonstrated that the experimental procedure developed in the present study could produce large quantities of active Tat4757-Oct4 fusion protein from P. pastoris.
24324071 Silencing of OCT4B confers sensitivity to cisplatin treatment in A549 cells via cell-cycle regulation, increased proliferation and enhancement of cisplatin-induced apoptosis
24320714 There was also no association between positive Oct4 and Nanog reactivity and tumor morphology, age, mitosis-karyorrhexis index, NMYC amplification, favorable or unfavorable histology, and risk groups.
24256943 BIO promoted cell survival and transiently sustained OCT4 expression at the early NI stage with FGF2 and SB431542.
24182453 staining of OCT4 is a sensitive marker of neuroendocrine differentiation that has yet to be described in any other tissue or tumor type.
24145198 an integrated view of OCT4 research conducted to date by reviewing the different functional roles for OCT4 and discussing the current progress in understanding their underlying molecular mechanisms. [review]
24105929 Data revealed a significant coupregulation of SOX2OT along with SOX2 and OCT4 in tumor samples, compared to the non-tumor tissues obtained from the margin of same tumors.
24073944 single-time transfection of the Oct4 expression vector may be a useful strategy for effective cell therapy. The use of cryopreserved hAMCs in cell therapy still requires more investigation
24070213 Oct4 and KPNA2 play an important role in non-small-cell lung cancer progression.
24038750 The importance of Sirt1 in mediating Oct4-dependent pluripotency is revealed by the finding that the ectopic expression of Sirt1 in Oct4-silenced hESCs prevents p53 activation and hESC differentiation.
23984394 Overexpression of PSCA and Oct-4 might be closely related to the carcinogenesis, progression, metastasis, or invasive potential and prognosis of gallbladder carcinoma.
23963638 Data demonstrate that Sox17EK has gained the ability to specify pluripotency by acquiring the capacity to interact with Oct4 and target selective genes.
23933063 Pluripotency-associated isoform Oct4A is not expressed by normal or malignant human urothelium and therefore is unlikely to play a role in a cancer stem cell phenotype.
23932306 POU5F1 expression in multipotent mesenchymal stem cells is not significantly different among chorionic villi, amniotic fluid, and placenta
23928699 OCT4 directly induces expression of miR-125b, which inhibits its direct target BAK1, leading to suppression of cervical cancer cell apoptosis.
23921511 the OCT4 cancer stem cell signaling pathway may mediate FSH-induced inhibition of apoptosis and could provide a target for treatment of ovarian cancer.
23917144 CD133 and Oct3/4 in cholangiocarcinoma are associated with increased formation of DNA lesions and the DDR protein, which may be involved in genetic instability and lead to cholangiocarcinoma development with aggressive clinical features.
23887079 CDX2 was significantly increased in neuroendocrine tumors of ileum, while the overexpression of Oct4 was not statistically significant in these tumors.
23872274 Knockdown of Oct4 and Nanog significantly reduced proliferation, migration, invasion, chemoresistance, and tumorigenesis of pancreatic cancer stem cells in vitro and in vivo.
23863554 A cytoplasmic OCT4 reactivity is valuable in diagnosing Merkel cell carcinoma.
23828673 Semiquantitative immunohistochemical analyses of Klf4, Sox2, c-Myc and Oct4 were studied in testes paraffin sections via light microscopy.
23736381 the expression of Oct-4, Nanog, Sox-2 and Stat-3 are related to differentiation in ameloblasts and odontoblasts.
23670345 OCT4 is epigenetically regulated by DNA hypomethylation in primary gliomas, which may provide evidence for the role of DNA methylation in tumor and may present a new direction for developing more powerful strategies to treat glioma in the clinic.
23643069 Chhorionic stem cells display improved Oct-4 expression and a high differentiation potential into mesodermal lineages and oligodendrocytes.
23636800 Expression of OCT4 isoforms correlated with biochemical and pathological parameters, particularly biochemical recurrence-free survival in patients with prostate cancer.
23615404 OCT4-pg4 functions as a natural micro RNA sponge to protect OCT4 transcript from being inhibited by miR-145.
23613880 Because both ID4 alone and a complex of SOX4 and OCT-4 activate SOX2 transcription, it is possible that multiple activation of SOX2 impair the prognosis of glioblastoma patients.
23613252 forced expression of OCT4 can alter cell status and activate the pluripotent network.
23609451 TR4-Oct4-IL1Ra axis may play a critical role in the development of chemoresistance in the PCa stem/progenitor cells.
23601300 Data indicate that OCT4 expression is related to metastasis and chemoresistance in lung adenocarcinoma patients, and thus indicates poor prognosis.
23594289 Stromal expression of Notch-1 may have a negative impact on disease progression, possibly through up-regulation of the active nuclear form of Oct-4 in carcinoma cells.
23588367 The goal of this study is to analyze the immunoreactivity of adrenal cortical carcinoma and pheochromocytoma to OCT4
23549118 Thus the interactomes of these two pluripotency genes could be an important part of the regulatory network in hESCs.
23545524 hOCT3 does not apperar to contribute significantly to fluoroquinolone disposition.
23541921 Linc-RoR (long intergenic non-protein coding RNA regulator of reprogramming) regulates endogenous Oct4, Nanog, and Sox2 expression in self-renewing and differentiating human embryonic stem cells.
23539445 show that IGF-IR-mediated POU5F1 expression to form a complex with beta-catenin and SOX2 is crucial for the self-renewal and oncogenic potentials of lung adenocarcinoma stem-like cells
23525564 Downregulation of OCT4 expression in neuroblastoma cells is associated with reduced cell proliferation and loss of colony formation ability on soft agar.
23499384 The DNA hydroxylase Tet1 facilitates pluripotent stem cell induction by promoting Oct4 demethylation and reactivation.
23438193 Positive correlation of Oct4 and ABCG2 to chemotherapeutic resistance in CD90(+)CD133(+) liver cancer stem cells.
23433354 OCT4 can upregulate BIRC5 and CCND1 expression by increasing their promoter activity. These factors collusively promotes HCC cell proliferation, and co-suppression of OCT4 and BIRC5 is potentially beneficial for HCC treatment.
23391989 We posit that this can in turn affect cell-matrix tension, focal adhesion kinase signaling and integrin-growth factor receptor crosstalk, which eventually modulates Oct4 expression in hESCs
23388106 The expressed OCT4 was functional.
23349823 Data indicate that the stem cell markers, Nanog, Oct-4 and SOX-2, were significantly upregulated in cisplatin resistant (CisR) lung cancer cell lines.
23340171 Oct-4 is required for an antiapoptotic behavior of chemoresistant colorectal cancer cells enriched for cancer stem cells. effects associated with STAT3/Survivin.
23314702 aberrant regulation of Oct4 in ovarian and breast cancer samples
23307247 an independent public expression profiling data showed signature for Oct4, Lin28 and Nanog could successfully be used to predict the survival of colorectal cancer patients
23302226 Oct-4-dependent high constitutive levels of this BH3-only protein prime embryonal carcinoma cells to undergo rapid and massive apoptosis in response to p53 activation.
23290742 The expression of OCT4 may contribute to the pathology of ectopic endometrial growth by stimulating the migration activity of endometrial cells.
23279472 Stable transgenic cell lineages were obtained and canine cells showed to be highly responsive to the integration and expression of human SOX2 and OCT4, also depending on the amount of virus used for incubation.
23276226 overexpression of OCT4 in donor cells increased H3K9me3 and did not reduce XIST gene expression, we show that a single transcription factor can affect the number of trophectoderm cells in bovine SCNT embryos.
23255053 identify Itch as a regulator of Oct4 stability and transcriptional activity, establishing a functional link between an E3 ligase and the regulation of pluripotency
23213213 OAC1 increases transcription of the Oct4-Nanog-Sox2 triad and Tet1, a gene known to be involved in DNA demethylation
23211052 Results indicate positive expression of SOX2, SOX3, PAX6, OCT3/4, and NANOG in the CD105+ and CD105(-) cell subpopulations.
23185410 OCT4 positively regulates Survivin expression to promote cancer cell proliferation and leads to poor prognosis in esophageal squamous cell carcinoma
23136034 MiR-302 inhibits NR2F2 and promotes pluripotency through indirect positive regulation of OCT4.
23088399 findings show C-MYC upregulates transcription of TIP110 through interaction with the TIP110 E-box in the TIP110 promoter, ensuring high-level Tip110 expression in proliferating embryonic stem cells (hESCs); further show TIP110 regulates OCT4 alternative splicing in hESCs
23076549 High OCT4 expression is associated with colorectal cancer cell migration and invasion by regulating epithelial-mesenchymal transition.
23052207 MBD6 is regulated by Ago2 via an interaction with Oct4, which alters self-renewal and gene expression in human adipose tissue-derived stem cells.
23041284 a site-specific, posttranslational modification of the Oct4 protein orchestrates the regulation of its stability, subcellular localization, and transcriptional activities, which collectively promotes the survival and tumorigenicity of embryonal carcinoma cells
23024368 Data indicate that OCT4A interacts with ERK1/2 and is phosphorylated at Ser-111, increasing its ubiquitination and degradation.
23002208 Data show that the loss of OCT4 expression under hypoxia can be triggered by sumoylation, which was regulated by the SUMO1 peptidase SENP1.
23000165 this study indicates that LRH-1 acts as a transcriptional activator in the regulation of OCT4 gene expression through the cooperative interaction with three binding sites directly or/and indirectly.
22944295 The expression of stem cell marker OCT-4 may serve as a poor prognostic marker in papillary renal cell carcinoma.
22922943 this study demonstrates an alteration in the expression pattern and nuclear translocation of Oct4 during gastric carcinogenesis.
22914767 Developmental failure of human ICSI embryos is associated with high methylation of the Oct4 promoter.
22903480 Our findings suggest that OCT4B1 plays a potential role in tumor initiation and/or progression of the bladder cancer.
22901285 samples represent a tumor-initiating cells (TICs) subset which may be either M- or S-type, and which is separate from the CD44(high)/Oct-4A(high) subset observed only in M-type samples.
22847005 Hyaluronan-CD44v3 interaction with Oct4-Sox2-Nanog promotes miR-302 expression leading to self-renewal, clonal formation, and cisplatin resistance in cancer stem cells from head and neck squamous cell carcinoma.
22844522 insights in Oct4A dynamics
22837720 Sox2 and Oct4 may act as the promising unit markers in directing NSCLC diagnosis and therapy. Also, Oct4 can be regarded as a novel predictor of poor prognosis for NSCLC patients undergoing resection.
22832160 The necessary and sufficient function of Oct4 in promoting pluripotency is to activate specific target genes.
22824146 OCT4 might serve as a promising biomarker for the diagnosis of highly recurrent cases of hepatocellular carcinoma and could be used as a valuable indicator for predicting the its prognosis.
22795133 Oct4 and Nanog directly regulate Dnmt1 to maintain self-renewal and undifferentiated state in mesenchymal stem cells
22777760 indicate that stem cell-related transcription factors Nanog, Oct-4 and Sox-2 were positively expressed in umbilical cord (UC)-mesenchymal stem cells (MSCs).
22743827 Co-localization of NANOG and OCT4 in human pre-implantation embryos from morula and blastocyst stages and in human embryonic stem cells
22727933 the cooperative nature of human embryonic stem cells is maintained by the E-cadherin-actin cytoskeleton system along with the restricted distribution of Oct3/4 in the nucleus
22613719 Findings describe the rapid, reproducible, and highly efficient generation of iPSCs derived from endogenous kidney tubular renal epithelial cells with only two transcriptional factors, OCT4 and SOX2.
22588915 OCT4 protein expression is associated with tumor differentiation and metastasis in bladder cancer.
22576801 expression of Oct4 and Sox2 may correlate with the genesis and progression of neuroblastoma
22528324 A variant of the POU5F1 gene was associated with an increased risk of recurrence of colorectal cancer
22506928 All cases of malignant germ cell tumors were positive for Octamer4/3
22482508 Distinct lineage specification roles for NANOG, OCT4, and SOX2 in human embryonic stem cells.
22474382 Data with functional analysis of two sites, T234 and S235, suggesting that phosphorylation within the homeobox region of OCT4 negatively regulates its activity by interrupting sequence-specific DNA binding.
22448662 All dysgerminomas were positive for OCT4, whereas all yolk sac tumors and immature teratomas were negative.
22446105 Data suggest that in embryonic stem cells [which express ETS2 (proto-oncogene c-ETS-2) but not CGA (alpha subunit chorionic gonadotropin)], ETS2 does not occupy its binding site on CGA promoter but is found instead as soluble complex with POU5F1.
22429998 We demonstrate that LDH-A reduction can suppress the tumorigenicity of intestinal-type gastric cancer (ITGC) cells by downregulating Oct4 both in vitro and in vivo.
22396540 Combining BMP4/WNT3A induction and OCT4/EpCAM selection can significantly increase the putative germ cell population with meiotic competency.
22393366 increased OCT4 expression at extreme altitude can directly elevate the expression of hemoglobin genes
22392999 Wnt/beta-catenin signaling promotes differentiation, not self-renewal, of human embryonic stem cells and is repressed by Oct4
22378186 miR-145 is involved in the tumorigenesis of cancer stem-like cells, potentially via the direct modulation of the downstream target Oct4
22363145 Data suggest that expression of OCT4 enables the tumor to have a higher degree of stemness, which in turn results in a poorer clinical outcome for patients with esophageal squamous cell carcinoma.
22340650 Both Oct4 and Nanog were highly expressed in CD24(+)CD44(+) pancreatic cancer stem cells.
22300949 overexpression of Oct-4 in tumor tissue represents a prognostic factor in primary NSCLC patients. Oct-4 may maintain NSCLC cells in a poorly differentiated state through a mechanism that depends on promoting cell proliferation.
22286766 Oct4-mediated tumor cell dedifferentiation may have an important role during tumor progression.
22252524 Data show that the expressions of Oct3/4 and Nanog were upregulated upon stimulation with Stem cell factor (SCF) and granulocyte colony-stimulating factor (G-CSF).
22247013 This work gives an insight into the novel function of OCT4B protein isoforms and helps us to understand the complex expression patterns and biological functions of OCT4 gene.
22207173 Oct-4 and Nestin were important regulators of the development of breast cancer.
22160855 Report comparative epigenetic analysis of Oct4 regulatory region in RA-induced differentiated NT2 cells under adherent and non-adherent culture conditions.
22037460 Oct4 overexpression enhances cancer stem cell-like properties of colorectal cancer cells, including sphere formation, cell colony formation, cell migration, invasiveness, and drug resistance.
22014056 We found a positive correlation between the expression levels of Oct4, Sox2 and Nanog and tumour malignancy in human glioma
21987575 Glioma-initiating cells retain their tumorigenicity through integration of the Sox axis and Oct4 protein.
21962512 Study reports using an unbiased in vitro transcription-biochemical complementation assay to discover a multisubunit stem cell coactivator complex (SCC) that is selectively required for the synergistic activation of the Nanog gene by Oct4 and Sox2.
21960344 5438 OCT4 binding sites were localized in the glioblastoma cancer genome and that these sites contained a consensus sequence TTTkswTw (k=T or G, s=C or G, w=A or T), which occurred 3931 times in 2312 OCT4 binding regions.
21951846 Oct3/4 expression was significantly increased in cells from S. haematobium-associated bladder cancer tissues in comparison to normal bladder and cancer tissues without infection.
21947321 In the hypoxic conditions, OCT4 and SOX2, both of which are induced by HIF1alpha/HIF2alpha. promote CD133 expression in the lung cancer cells via their direct interaction with the P1 promoter.
21946204 There is a negative corelation between the expression of HIF-2alpha and OCT-4 and the prognosis of non-small cell lung cancer.
21938739 Oct-3/4 might contribute to tumor promoting activity in glioblastomas
21900452 Oct4A levels and differentiation potential of papillary CD133(+) cells were higher than those of CD133(+) cells from cortical tubuli. Hypoxia was able to promote the undifferentiated phenotype of CD133(+) progenitors from papilla
21868340 The expressions of Oct4 and CD133 are upregulated in colonic cancer compared with those in the adjacent tissues and show a positive correlation.
21852325 Data show that nuclear expression of the pluripotency-associated stem cell marker complex OCT4/SOX2/NANOG was confirmed in ISCs.
21844352 OCT4 establishes and maintains nucleosome-depleted regions that provide additional layers of epigenetic regulation of its target genes.
21804543 Data show that FOXO1 activates the expression of OCT4 and SOX2 pluripotency genes in hESCs by binding directly to their regulatory regions.
21798248 silencing Oct4 promotes invasion and metastasis in breast cancer cells by inducing epithelial-to-mesenchymal transition.
21725800 Our findings reveal a previously unknown prognostic value for OCT4 expression status in medulloblastoma
21692598 The proximity of undifferentiated gonadal tissue with the tumors as well as the immunostaining patterns (PLAP+, OCT3/4+, and CD117/KIT+) suggests that germ cells found in them are a risk factor for gonadal tumors.
21684074 findings suggest a functional and distinct role for OCT4B1 transcript and protein in stress-response and apoptosis
21674242 expression of Oct4 may be associated with the colony formation of cervical cancer cells, but DNMT3A is not involved in the regulation of Oct4 expression
21631526 forced down-regulation of the pluripotency markers OCT34, LIN28 and SOX2 in the embryonal carcinoma cell line NT2 resulted in loss of stem cell characteristics, and induction of differentiation, preferentially in ectodermal and mesodermal lineages
21602158 Oct-4 expression was negative in normal skin and showed a significant difference between squamous cell carcinoma and seborrheic keratosis tissues.
21602143 siRNA-mediated OCT4 gene silencing can inhibit the proliferation and induce apoptosis of pancreatic carcinoma PANC1 cells.
21559451 in human embryonic stem cells nocodazole reversible blocks cell cycle, which is accompanied by irreversible loss of expression of pluripotency markers Nanog and Oct4
21547540 The over-expression of Oct4 in esophageal squamous cell carcinoma (ESCCs) suggests that it is a potential target for ESCC therapy.
21533858 High OCT-4 expression is associated with the development of high-grade bladder cancer and with the bladder cancer recurrence.
21496429 MiR-145 can inhibit the proliferation of lung cancer stem cells in A549 cell line via down-regulating OCT4 expression.
21480394 data imply that OCT4B1 isoform may represent a potential biomarker for the initiation, progression, and differentiation of colorectal carcinoma
21479367 miR-145 can impair the proliferation of human lung adenocarcinoma-initiating cells by targeting OCT4
21419292 expression of reprogramming marker Oct-4, was detectable in the early passaged DPCs, and sequential loss of this marker in nucleus during DPC cultures might be related to the cell fate of pulp derived cells during the long-term in vitro cultivation.
21403679 NB tumors two putative niches containing Oct-4(+) tumor cells. Oct-4(+)/TNC(+) perivascular NB cells displayed a high degree of plasticity and served as progenitors of TECs.
21394007 Oct-4 protein expressed significantly higher in cancerous tissues than adjacent-tumor tissues. Moreover, we observed that the expression of Oct-4 protein was related to histological type, lymph node status and molecular type of breast cancer.
21376027 Analyses revealed that Sox2 or Oct4A was an independent prognostic factor for hepatocellular carcinoma HCC.
21365617 Our results strongly suggested that miR-145 is a tumor cell differentiation-inducing agent in endometrial carcinoma
21301344 rs3130932 single nucleotide polymorphism in the OCT4B translation initiation codon is not associated with cancer.
21273125 New candidate gene POU5F1 associated with premature ovarian failure in Chinese patients.
21262915 Results suggested that therapeutic effects of RA-induced leukemia differentiation depend on AhR and its ability to downregulate the stem cell factor Oct4.
21227461 Sox2 and Oct3/4 might be independent prognostic factors for patients with gastric cancer.
21166886 Mesenchymal stem cells maintained in the medium supplemented with ascorbic acid for a period of 4 weeks showed increase in pluripotency markers Oct4 and SOX 2
21159654 Results support the notion that the Oct4/Nanog signaling controls epithelial-mesenchymal transdifferentiation, regulates tumor-initiating ability, and promotes metastasis of lung adencarcinoma.
21151097 In undifferentiated stem cells, both OCT4 and the OCT4-induced miR-302 directly repress NR2F2 at the transcriptional and post-transcriptional level, respectively.
21135096 Nuclear orphan receptor TLX induces Oct-3/4 for the survival and maintenance of adult hippocampal progenitors upon hypoxia.
21107090 Oct4 expression was exclusively detected in immature neuroepithelium of high-grade immature teratomas.
20981110 Transient expression of OCT4 is sufficient to allow human keratinocytes to change their differentiation pathway.
20958186 findings show the basal layer of corneal epithelium expresses OCT4
20942235 In thyroid papillary carcinomas, the expression of Oct-4 was higher than that in thyroid adenoma, and had no obvious relationship with the patients age, sex, the size and location of tumor and tumor metastasis.
20937145 Simultaneous analyses of Oct4 and Sox2 expression could be more effective in evaluating the prognoses of patients with hypopharyngeal squamous cell carcinoma
20879854 All cultured mesenchymal stem cells (MSC) populations, independently from the tissue of origin, express the embryonic transcription factor NANOG, whereas OCT-4 and SOX-2 are not expressed.
20858707 The selectivity and kinetics of monoamine neurotransmitter transport by PMAT and OCT3 was determined. PMAT is expressed at much higher levels than hOCT3 in brain, whereas hOCT3 is selectively and highly expressed in adrenal gland and skeletal muscle.
20824712 High OCT4 isoform expression is associated with gastric cancer.
20818602 High OCT4 is associated with lung adenocarcinoma.
20805580 The Oct-4B eventually disappeared in mature germ cells, viz. spermatocytes, spermatids, and sperm.
20736927 Oct-3/4 regulates stem cell identity and cell fate decisions by modulating Wnt/beta-catenin signalling.
20721963 we observed higher levels of expression and atypical cytoplasmic distribution of OCT4A and not OCT4B, in the malignant setting, strongly indicating an oncogenic role in lung adenocarcinoma.
20698766 results provide proof that hGMDCs can be reprogrammed into pluripotent cells by ectopic expression of three factors (OCT4, SOX2, and NANOG) without the use of oncogenes c-MYC and KLF4
20662612 expression in bone marrow-derived mesenchymal stem cells did not differ between children and adults
20647538 Data show that the centers of initiation and the direction of replication fork progression through the POU5F1 gene are conserved in two independent human embryonic stem cell (hESC) lines but different in hESC-derived multipotent and endothelial cells.
20594032 enhancer site 2A in the 5' UTR is sufficient for inducing the expression of the Oct4 gene in bone marrow derived mesenchymal stem cells, and site 2B is not required
20587610 Observational study of gene-disease association. (HuGE Navigator)
20510497 results demonstrate that hADCs were an ideal somatic cell resource for the rapid and efficient generation of iPS cells by OCT4/SOX2/NANOG
20505821 SALL4 is a master regulator that controls its own expression and the expression of OCT4.
20505756 Putative direct downstream targets of OCT4 were identified by employing chromatin immunoprecipitation-on-chip analysis.
20497257 Our results indicate that the effects of 5-aza-dC on histone methylation profiles are gene-specific and that aberrant histone modifications may serve as a principal means of misregulation of RASSF1A and POU5F1 expression in testis cancer.
20477760 WRNp localizes to the Oct4 promoter during retinoic acid-induced differentiation of human pluripotent cells and associates with the de novo methyltransferase Dnmt3b in the chromatin of differentiating pluripotent cells.
20462980 Data show that the cancer cells with bronchioalveolar stem cells phenotype are detectable in adenocarcinoma of the lung and the expression of self-renewal regulatory gene OCT4 in these cells indicated the worse clinical outcomes.
20458727 The presence of nanog, Oct-4, SSEA-1, and SSEA-4 suggests that periodontal ligament mesenchymal stem cells are less differentiated than bone marrow-derived MSCs, and the frizzled-9/Wnt pathway is important in proliferation and differentiation.
20458727 The presence of nanog, Oct-4, SSEA-1, and SSEA-4 suggests that periodontal ligament mesenchymal stem cells are less differentiated than bone marrow-derived MSCs, and that the frizzled-9/Wnt pathway is important in proliferation and differentiation.
20433421 findings show Oct-4B is differentially expressed in MCF-7 cells; suggest hypermethylation of regulatory regions contributes to Oct-4A silencing and expression of Oct-4B is regulated by distinct regulatory elements and unique transcriptional start site
20412747 3 isoforms exist. They play a role in embryonic stem cells and blastocysts, cell differentiation, cardiac mesoderm formation, chromatin remodeling and maintenance of pluripotency. Review.
20412569 Data suggest endometrial OCT4 is not involved in or modulated by hormone-induced cyclical changes of the endometrium.
20404147 The reactivity to OCT4-derived peptides resides primarily in the CD45RO(+) memory T-cell compartment and consists predominantly of CD4(+) T cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20356403 All tested cell types expressed Oct4 pseudogenes. Somatic cells could not utilize an exogenous Oct4 promoter construct. Oct4 does not appear involved in the multipotency of human haematopoietic stem cells derived from human umbilical cord blood.
20347080 The expression analysis of genes OCT4, SRY, and TSPY in the dysgenetic gonads of Turner syndrome patients may allow introducing modifications in the microenvironment that could contributed to a malignant transformation process.
20333750 This review article underscores the importance of identifying and discriminating the expression and functions of OCT4 isoforms in stem cell research.
20230781 a 30-nt sequence (nt 201-231), which is sufficient to promote internal initiation of translation of OCT4B mRNA in embryonic stem cells was mapped.
20203285 EWS-POU5F1 has a role in sarcomagenesis and tumor cell maintenance
20173672 The strong expression of Oct4 and Nanog in metaplastic ducts and Oct4 expression preceding Ras mutation suggests that they are associated with the early stage of pancreatic cancer carcinogenesis and may play an important role in that process.
20171362 OCT4 messenger RNA levels increased more than three-fold in side population dental pulp cells after exposure to ischemic culture conditions for 48 hours.
20139178 Both Oct-4 isoforms are upregulated and potentially have a significant role in the development of vascular abnormalities associated with the pathogenesis of idiopathic pulmonary arterial hypertension.
20123703 OCT4 and associated genes are expressed in somatic epithelial cells from the urogenital tract and that these cells can form spheres, a general marker of stem cell behaviour
20103622 Data show that a significant number of the genes contained binding sites for the stem cell transcription factors Oct4 and Nanog.
20101213 Lin28 and Oct4 may have important roles in the initiation and/or progression of epithelial ovarian cancer.
20074550 Wnt/beta-catenin signaling plays an important role in lung cancer stem cell properties, and it also regulates OCT-4, a lung cancer stem cell marker.
20054811 Review. Transcriptional regulation of Oct4 gene.
20051954 results suggest oncogenic effect of the t(6;22) translocation is due to EWS-Oct-4B chimeric protein & that alternative fusion of EWS amino terminal domain to the Oct-4 DNA-binding domain produces another transforming chimeric product in epithelial tumours
20038322 The positive rate of OCT4A mRNA expression was significantly higher in hepatocellular carcinoma tissues than in non-neoplastic liver tissues.
20034424 Review. Oct-4 transcription factor regulating the expression of Stella and Foxj2 at the Nanog locus could play a pivotal role in the establishment of the oocyte's developmental competence.
19969351 Lucena cells showed an over-expression of the ABCB1 gene and a high expression of the Oct-4, ABCG2 and ABCC1 genes as compared to K562 cells.
19968627 Oct-4 down-regulation in embryonic stem cells inhibits proliferation by blocking cell-cycle progression in G0/G1.
19966271 Results suggest a role for Lin28 in the regulation of Oct4 translation.
19851445 Observational study of gene-disease association. (HuGE Navigator)
19816951 show that Klf4 interacts directly with Oct4 and Sox2 when expressed at levels sufficient to induce induced pluripotent stem cells.
19777066 Oct4 has a role in cell proliferation and differentiation in adipose tissue stromal cells
19751112 Myostatin or 20 ng/mL BMP-11 maintain the colony and cellular morphology of undifferentiated hESC, maintain POU5f1, NANOG, TRA-1-60, and SSEA4 expression, and display increased SMAD2/3 phosphorylation
19736317 Data reveal a molecular Oct4-, Sox2- and Sox17-mediated mechanism that disrupts the stem cell microenvironment favoring pluripotency to provide an endodermal environment in which cell lineage is determined and commits the cells to a cardiogenic fate.
19718018 transcription factor OCT4 is sufficient to reprogram human neural stem cells to pluripotency
19696409 Induced pluripotent stem cells programmed with OCT4/SOX2/KLF4 and without c-MYC yield proficient cardiogenesis for functional heart chimerism.
19657699 High OCT4 levels are associated with distant recurrence after chemoradiotherapy in rectal cancer pateints.
19559696 These results imply that cells of mesenchymal origin can be traced back to cells of embryonic phenotype by the OCT4/3 gene in collaboration with the potent cis-regulatory element and the fused co-activator EWS.
19549847 Stoichiometric and temporal requirements of Oct4, Sox2, Klf4, and c-Myc expression for efficient human iPSC induction and differentiation.
19489092 Shows that isoform OCT4B-190 initiates at a non-AUG (CUG) translation initiation codon.
19489092 OCT4 gene, by the regulation of alternative splicing and alternative translation initiation, may carry out more crucial roles in many biological events.
19483629 This study evaluates the use of the markers, podoplanin, SOX2, NANOG, and OCT3/4 in ovarian tumors
19458492 Studies show that the expression of genes belonging to the OCT3/SOX2/NANOG/KLF4 core circuitry that acts at the highest level in regulating stem cell biology.
19445899 These results suggest that the inhibitory effect of hOCT4 is mediated by transactivation domains, and that the self-regulation of hOCT4 may be mediated via a negative feedback loop in pluripotent cells.
19438894 Oct-4A, which is associated with self-renewal in embryonic stem cells, neither defines nor confers self-renewal to CD133 stem cells
19414369 High Oct3 expression is associated with squamous cell carcinoma.
19409607 Increased miR-145 expression inhibits human embryonic stem cells self-renewal, represses expression of pluripotency genes, and induces lineage-restricted differentiation; loss of miR-145 impairs differentiation and elevates OCT4, SOX2, and KLF4.
19396148 staining patterns were OCT3/4 -3+, all seminomas, embryonal carcinomas and intra-tubular germ cell neoplasia
19394308 these finding suggest that OCT4A performs functionally conserved roles in human umbilical cord blood-derived multipotent stem cells.
19383152 Pou5f1/Oct4 is modified by O-GlcNAc in human embryonic stem cells.
19350677 knockdown of OCT4 resulted in rapid differentiation of human embryonic stem cells
19347886 Oct4 expression levels were higher in gastric carcinoma tissues compared to matching, adjacent non-cancerous tissues, atrophic gastritis and gastric ulcer tissues.
19327014 Results suggest that DAZL-expressing (DE)cells, which possess some pluripotent/multipotent characteristics of
19274762 only the cytoplasmic isoform 2 of Oct 3/4 is present in prostate cancer and benign prostate hyperplasia
19271143 Data suggest that OCT2 and/or OCT3 might be involved in the initial component of histamine uptake, whereas the later component of histamine uptake is likely to be mediated by another, as yet undefined uptake system(s).
19224238 Oct4 is a marker for pancreatic endocrine progenitor.
19224167 Oct4 gene was related with proliferation ability of T24 cells, but not with invasive capability.
19171782 we show that association of Oct4 and Oct1 with a distinct group of in vivo targets is inducible by stress, and that Oct1 is essential for a normal post-stress transcriptional response
19170206 found that EWS-Oct-4-mediated transcriptional activation was inhibited by EWS-Oct-4 (V351P) protein in vivo. Thus, this mutation in the POU DNA-binding domain results in a dominant negative protein
19126554 Comparative studies of OCT4 in adenocarcinoma and bronchioloalveolar carcinoma tumor cell cultures demonstrated a dramatically higher expression in the former.
19103427 data suggest that Oct4 nuclear localization may be mediated by its interaction with KPNA-2
19102659 Effects of ectopic Nanog and Oct4 overexpression on mesenchymal stem cells.
19058139 The increased number of cells that expressed Oct4A in prostate cancer compared to benign prostate, and in cancers of increasing grade, suggests that Oct4A/Chromogranin A co-expressing cells represent neuroendocrine cells in prostate cancer.
19023518 analysis of expression of OCT4 in tumor cell lines from 13 entities & bone marrow-derived mesenchymal stem cells (MSC); with exception of typical embryonal carcinoma cells, we did not observe reliable OCT4 expression in somatic tumor cell lines & MSC
18985733 study reported that Oct4 was highly expressed in gliomas and glioma cell lines, and the expression levels were increased in parallel with increasing glioma grades
18957414 Esrrb coordinates with Nanog and Oct4 to activate the internal machinery of ES cells
18946985 Identification of the OCT4-pg1 retrogene and NANOG gene expression in the human embryonic eye
18810488 The hOct4 promoter is differently regulated in mouse cells.
18787205 OCT4 spliced variants are differentially expressed in human pluripotent and nonpluripotent cells
18765667 Novel variants of Oct-3/4 gene expressed in mouse somatic cells
18710938 The transcriptional activation of miR-302 and the translational repression of its targets, such as cyclin D1, may provide a link between Oct4/Sox2 and cell cycle regulation in pluripotent cells.
18676852 results implicate that Oct-3/4 may be useful as a novel tumor biological and prognostic marker and probably as a potential therapeutic target for bladder cancer
18617685 MSC stemness does not correlate to expression of POU5F1 transcripts or its pseudogenes.
18612434 Oct-4 expression plays a crucial role in maintaining the self-renewing, cancer stem-like, and chemoradioresistant properties of LC-CD133(+).
18593985 Oct-4 and Nanog may have roles in oral cancer stem-like cells and high-grade oral squamous cell carcinoma
18467432 Differential expression of the pluripotency structural gene OCT4 in human preimplantation development.
18440631 Oct4 is down-regulated by hypermethylation in normal placenta and gestational trophoblastic diseases.
18439155 Immunohistochemical localization of Oct4 in stem cell compartments of human sacrococcygeal teratomas
18388306 Sox2, Oct4 and Nanog are linked together in a pluripotent regulatory network
18366076 Thsi study identifies DPPA4 and other genes as putative Sox2:Oct-3/4 target genes using a combination of in silico analysis and transcription-based assays.
18338169 A comparatively homogeneous population of multipotent adult progenitor cells are able to transcripbe Oct4 protein.[REVIEW]
18295396 We conclude that the proliferation of immature germ cells in GB may be due to an interaction between OCT3/4 and accumulated beta-catenin in the nuclei of the immature germ cells.
18269588 OCT-4 expression was not detected in patients with basal-like phenotype of breast cancer.
18254969 POU5F1 is highly polymorphic, however a smaller subset of polymorphisms can tag the observed genetic variation with little loss of information
18231740 The positive rate and density of Oct4 expression had no obvious relationship with the grade, recurrence or metastasis of bladder cancer.
18199879 The human primordial germ cells is the first primary cell type described to express POU5F1 and NANOG but not SOX2.
18157115 Using ectopic expression of Oct4, Sox2, Klf4 and Myc, we have derived iPS cells from fetal, neonatal and adult human primary cells
18088417 OCT4 mRNA and protein were detected in extracts from both 1st and 2nd trimester ovaries and testes.
18032701 OCT4 expression in the cervical carcinoma cell line HeLa and the breast cancer cell line MCF7 was determined in comparison with the human teratoma cell line nTera.
17959850 Both upregulation and downregulation of Oct4 in human embryonic stem cells results in differentiation, but with patterns distinct from parallel experiments in mice.
17923501 SARS-infected lung cells express the stem/progenitor cell markers CD34 and Oct-4.
17761754 OCT4 targets similiar genes in mesenchmal and embryonic stem cells and promotes the expression of specific genes and cell cycle progession in each type of cell.
17682839 possible role of the OCT-4 protein in seminomas
17573914 In pluripotent human embryonic stem cells (unlike differentiated hES) Oct4 genes were located on greatly extended chromatin loops, outside their respective chromosome sites, suggesting role in pluripotency of hES.
17549357 Differential methylation of the OCT3/4 upstream region is associated with primary testicular germ cell tumors
17525163 sumoylation of Oct4 results in increased stability, DNA binding, and transactivation and provides an important mechanism to regulate Oct4 activity
17506876 RNAi-mediated silencing of OCT4 induced differentiation with mesodermal characteristics in EC cells
17413979 Our results suggest that an immunohistochemical panel consisting of TTF-1, CEA, CA-125, and OCT-4 is helpful in distinguishing most pulmonary and ovarian carcinomas with clear cell features.
17409736 Stem cell marker expressed in dental pulp stem cells from 5-7 year olds.
17390031 WNT8B expression in hepatocyte progenitors derived from human ES cells is due to POU5F1 (OCT3/OCT4) and GATA3, and WNT8B expression in diffuse-type gastric cancer is due to POU5F1 and GATA6
17379765 Human peripheral blood mononuclear cells, genetically stable and mainly terminally differentiated cells with well defined functions and a limited lifespan, express Oct-4.
17314394 reprogramming of DNA methylation and histone modifications on regulatory regions of the developmentally regulated OCT4 and NANOG genes
17314032 genetic association study shows that only a haplotype containing Cw*0602 is strongly associated with psoriasis vulgaris in Chinese; POU5F1 gene is unlikely to be the disease gene at PSORS1 locus
17273778 POU5F1 and POU2F subfamily members play a pivotal role for the FZD5 expression in undifferentiated human ES cells, fetal liver/spleen, adult colon, pancreatic islet, and diffuse-type gastric cancer
17226773 These data indicate that SF-1 plays a crucial role in the regulation of hOct4 transcription through direct binding to the 1st SF-1 in Conserved Regions 1 of the hOct4 proximal promoter.
17211834 Data show that Oct-4, Rex-1, and Gata-4 expression in human mesenchymal stem cells increases cell differentiation efficiency but not hTERT expression.
17205510 OCT-4, an embryonic stem cell marker, is highly expressed in bladder cancer
17136117 Isolation from cord blood a population of human cells that are similar to murine bone marrow-derived cells containing OCT4.
17068183 RNA interference-mediated suppression of OCT4 function in a human ESC line and analysis of the resulting transcriptional profiles to identify OCT4-dependent genes in human cells.
16951404 DNA binding, transactivation, and abilities to confer self-renewal of the human OCT-4 isoforms differ
16916925 Expression of POU5F1 isoform A and POU5F1_isoform B was examined in hESCs and all stages of human preimplantation development to look for differences in expression, biological activity, and relation to totipotency.
16557044 data suggest that loss of Oct-3/4 expression leads to induction of a higher apoptotic threshold and to cisplatin resistance in embryonal carcinoma cells of nonseminomatous testicular germ cell tumors
16421218 Most stem cell marker Oct-4-expressing cells can be seen in the endometrium at the beginning or middle of the menstrual cycle, mainly in stromal cells.
16229821 results suggest that pseudogenes Oct4-pg5 and Oct4-pg1 may be involved in the regulation of Oct4 gene activity thus might be pertinent to carcinogenesis
16153702 The Oct4 protein co-occupy a substantial portion of its target genes, and collaborate to form regulatory circuitry consisting of autoregulatory and feedforward loops.
16149048 The hOct4 promoter upstream region contains multiple regulatory elements, one of which, the GC box, may be an important cis-regulatory element that regulates the transcription of the hOct4 promoter by the binding of Sp family transcription factors.
15917470 Oct-4-mediated transactivation is stimulated by EWS
15790780 MAPCs express the OCT4 and REX1 transcription factors, two specific markers of undifferentiated embryonic stem (ES) cells.
15749924 Gene knockdown of Oct4 promotes differentiation, thereby demonstrating a role for these factors in human embryonic stem cell self-renewal.
15695770 Oct-4 mRNA and protein expression during human preimplantation development was studied.
15625129 The Oct4 is an important marker of the undifferentiated state and a central regulator of pluripotency in ES cells.
15615706 demonstrated changes in DNA methylation in the promoter regions of Nanog and Oct-4 in a human cell line during retinoic acid-induced differentiation
15513931 Adult stem cells maintain expression of Oct4, consistent with the stem cell hypothesis of carcinogenesis.
15467907 expression of Oct-4 indicates a pluripotent phenotype of CD133(+) cells and appears to be of functional relevance
15342930 Oct4 is required to maintain the undifferentiated stem cell state, and differentiation to trophectoderm occurs in its absence.
15105401 Normal pattern of expression is disturbed in dysgenetic gonads, especially in rare intersex cases, thus increasing risk of malignant transformation. High abundance of OCT-3/4 in carcinoma in situ is consistent with early fetal origin and pluripotency.
12923055 Oct4 can dimerize onto DNA in a distinct conformational arrangement.
12841847 FGF4 is upregulated by the OCT3 transcription factor in breast cancer cells.
12653732 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFC      1 - 70
GGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIK     71 - 140
ALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEE    141 - 210
ADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCN    211 - 280
RRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSV    281 - 350
TTLGSPMHSN                                                                351 - 360
//

Text Mined References (440)

PMID Year Title
27067776 2016 The prognostic significance of OCT4 expression in patients with prostate cancer.
26996130 2016 Oct4 plays a crucial role in the maintenance of gefitinib-resistant lung cancer stem cells.
26992828 2016 Sox2/Oct4: A delicately balanced partnership in pluripotent stem cells and embryogenesis.
26940070 2016 Helicobacter pylori upregulates Nanog and Oct4 via Wnt/?-catenin signaling pathway to promote cancer stem cell-like properties in human gastric cancer.
26927547 2016 [Cloning and expression of human octamer-binding protein-4 (Oct4) cDNA in Escherichia coli and HEK293T cells].
26824036 2015 Potentially Functional Polymorphisms in POU5F1 Gene Are Associated with the Risk of Lung Cancer in Han Chinese.
26769970 2016 Germ Cell Nuclear Factor (GCNF) Represses Oct4 Expression and Globally Modulates Gene Expression in Human Embryonic Stem (hES) Cells.
26706028 2015 Clinical significance of OCT4 and SOX2 protein expression in cervical cancer.
26687479 2015 The variant Polycomb Repressor Complex 1 component PCGF1 interacts with a pluripotency sub-network that includes DPPA4, a regulator of embryogenesis.
26654770 2015 Novel AKT phosphorylation sites identified in the pluripotency factors OCT4, SOX2 and KLF4.
26639784 2015 GLUT3 and PKM2 regulate OCT4 expression and support the hypoxic culture of human embryonic stem cells.
26562475 2015 Oct4 is a reliable marker of liver tumor propagating cells in hepatocellular carcinoma.
26507003 2015 Evaluation of regulatory genetic variants in POU5F1 and risk of congenital heart disease in Han Chinese.
26483189 2015 Expression of Oct3/4 and Nanog in the head and neck squamous carcinoma cells and its clinical implications for delayed neck metastasis in stage I/II oral tongue squamous cell carcinoma.
26426078 2015 ZIC2-dependent OCT4 activation drives self-renewal of human liver cancer stem cells.
26417682 2015 DPF2 regulates OCT4 protein level and nuclear distribution.
26411902 2015 OCT4 Coordinates with WNT Signaling to Pre-pattern Chromatin at the SOX17 Locus during Human ES Cell Differentiation into Definitive Endoderm.
26398480 2015 OCT4B1 promotes cell growth, migration and invasion suppressing sensitivity to ?xaliplatin in colon cancer.
26339387 2015 SOX-2, but not Oct4, is highly expressed in early-stage endometrial adenocarcinoma and is related to tumour grading.
26260289 2015 A critical role of Oct4A in mediating metastasis and disease-free survival in a mouse model of ovarian cancer.
26230571 2015 Inducible Lentivirus-Mediated Expression of the Oct4 Gene Affects Multilineage Differentiation of Adult Human Bone Marrow-Derived Mesenchymal Stem Cells.
26202933 2016 Activation of OCT4 enhances ex vivo expansion of human cord blood hematopoietic stem and progenitor cells by regulating HOXB4 expression.
26152287 2015 High expression of OCT4 is frequent and may cause undesirable treatment outcomes in patients with acute myeloid leukemia.
26125892 2015 Expression and significance of S100P, CD147, and OCT4 in different prostate cancer tissue TNM stages.
26102294 2015 Role of stress-activated OCT4A in the cell fate decisions of embryonal carcinoma cells treated with etoposide.
26013162 2015 SRY and OCT4 Are Required for the Acquisition of Cancer Stem Cell-Like Properties and Are Potential Differentiation Therapy Targets.
25921273 2015 ?-Catenin Regulates Primitive Streak Induction through Collaborative Interactions with SMAD2/SMAD3 and OCT4.
25911324 2015 OCT4 mediates FSH-induced epithelial-mesenchymal transition and invasion through the ERK1/2 signaling pathway in epithelial ovarian cancer.
25907774 2015 Gene expression of OCT4, SOX2, KLF4 and MYC (OSKM) induced pluripotent stem cells: identification for potential mechanisms.
25880909 2015 Functional interplay between MYCN, NCYM, and OCT4 promotes aggressiveness of human neuroblastomas.
25879771 2015 Coexpression of gene Oct4 and Nanog initiates stem cell characteristics in hepatocellular carcinoma and promotes epithelial-mesenchymal transition through activation of Stat3/Snail signaling.
25858147 2015 Lin28B/Let-7 Regulates Expression of Oct4 and Sox2 and Reprograms Oral Squamous Cell Carcinoma Cells to a Stem-like State.
25826722 2015 Prolonged proteasome inhibition cyclically upregulates Oct3/4 and Nanog gene expression, but reduces induced pluripotent stem cell colony formation.
25816351 2015 The differential expression of OCT4 isoforms in cervical carcinoma.
25815323 2015 Effect of luteolin and apigenin on the expression of Oct-4, Sox2, and c-Myc in dental pulp cells with in vitro culture.
25754111 2015 YAP1 Regulates OCT4 Activity and SOX2 Expression to Facilitate Self-Renewal and Vascular Mimicry of Stem-Like Cells.
25664710 2015 Genetic determinants associated with early age of diagnosis of IBD.
25644290 2015 Oct-3/4 modulates the drug-resistant phenotype of glioblastoma cells through expression of ATP binding cassette transporter G2.
25634023 2015 OCT4 pseudogene 5 upregulates OCT4 expression to promote proliferation by competing with miR-145 in endometrial carcinoma.
25625591 2015 Akt?mediated phosphorylation of Oct4 is associated with the proliferation of stem?like cancer cells.
25609695 2015 Global Oct4 target gene analysis reveals novel downstream PTEN and TNC genes required for drug-resistance and metastasis in lung cancer.
25603874 2015 [Interaction between microRNAs and OCT4].
25564572 2015 Activation of IL6/IGFIR confers poor prognosis of HBV-related hepatocellular carcinoma through induction of OCT4/NANOG expression.
25474420 2014 TALEN/CRISPR-mediated eGFP knock-in add-on at the OCT4 locus does not impact differentiation of human embryonic stem cells towards endoderm.
25474139 2015 CIP2A is an Oct4 target gene involved in head and neck squamous cell cancer oncogenicity and radioresistance.
25464862 2015 Transcription factor decoy against stem cells master regulators, Nanog and Oct-4: a possible approach for differentiation therapy.
25422984 2015 Induced overexpression of Oct4A in human dental pulp cells enhances pluripotency and multilineage differentiation capability.
25420671 2015 Octamer-binding protein 4 affects the cell biology and phenotypic transition of lung cancer cells involving ?-catenin/E-cadherin complex degradation.
25405855 2015 Reduced tumorigenicity and drug resistance through the downregulation of octamer-binding protein 4 and Nanog transcriptional factor expression in human breast stem cells.
25355676 2015 Nuclear actin activates human transcription factor genes including the OCT4 gene.
25355160 2015 OCT4 mutations in human erythroleukemic cells: implications for multiple drug resistance (MDR) phenotype.
25353179 2014 OCT4 expression and vasculogenic mimicry formation positively correlate with poor prognosis in human breast cancer.
25328136 2015 DNMT-dependent suppression of microRNA regulates the induction of GBM tumor-propagating phenotype by Oct4 and Sox2.
25324523 2014 A nontranscriptional role for Oct4 in the regulation of mitotic entry.
25322154 2014 Concurrent expression of Oct4 and Nanog maintains mesenchymal stem-like property of human dental pulp cells.
25301732 2014 Oct-4 and Nanog promote the epithelial-mesenchymal transition of breast cancer stem cells and are associated with poor prognosis in breast cancer patients.
25223935 2014 Significant association of combination of OCT4, NANOG, and SOX2 gene polymorphisms in susceptibility and response to treatment in North Indian breast cancer patients.
25175567 2015 Aberrant expression and significance of OCT-4A transcription factor in leukemia cells.
25175483 2014 Differential expression of stem cell markers and ABCG2 in recurrent prostate cancer.
25174942 2014 Effects of lentiviral infection of mesenchymal stem cells on the expression of octamer transcription factor 4.
25128069 2014 Transcription factor OCT4 promotes cell cycle progression by regulating CCND1 expression in esophageal carcinoma.
25124662 2014 Over-expression of Oct4 and Sox2 transcription factors enhances differentiation of human umbilical cord blood cells in vivo.
25057990 2014 Gene networks of fully connected triads with complete auto-activation enable multistability and stepwise stochastic transitions.
25037576 2014 Coexpression of HMGA2 and Oct4 predicts an unfavorable prognosis in human gastric cancer.
25017645 2014 Knockdown of OCT4 suppresses the growth and invasion of pancreatic cancer cells through inhibition of the AKT pathway.
25008565 2014 Altered expression of apoptotic genes in response to OCT4B1 suppression in human tumor cell lines.
24983502 2014 Transcriptional activation of OCT4 by the ETS transcription factor PEA3 in NCCIT human embryonic carcinoma cells.
24971534 2014 Transcriptional regulation of OCT4 by the ETS transcription factor ESE-1 in NCCIT human embryonic carcinoma cells.
24966958 2014 Embryonic stem cell markers Sox-2 and OCT4 expression and their correlation with WNT signal pathway in cervical squamous cell carcinoma.
24954502 2015 Oct4 is a critical regulator of stemness in head and neck squamous carcinoma cells.
24945968 2014 Exogenous expression of OCT4 facilitates oocyte-mediated reprogramming in cloned porcine embryos.
24944491 2014 Influence of adriamycin on changes in Nanog, Oct-4, Sox2, ARID1 and Wnt5b expression in liver cancer stem cells.
24934529 2014 [Yamanaka's factors and core transcription factors--the molecular link between embryogenesis and carcinogenesis].
24871033 2014 Wnt/?-catenin signalling maintains self-renewal and tumourigenicity of head and neck squamous cell carcinoma stem-like cells by activating Oct4.
24870750 2014 Comparative analysis of Oct4 in different histological subtypes of esophageal squamous cell carcinomas in different clinical conditions.
24859837 2014 MiR-335 functions as a tumor suppressor in pancreatic cancer by targeting OCT4.
24845530 2014 Noninvasive reporter gene imaging of human Oct4 (pluripotency) dynamics during the differentiation of embryonic stem cells in living subjects.
24740884 2014 Molecular evidence for OCT4-induced plasticity in adult human fibroblasts required for direct cell fate conversion to lineage specific progenitors.
24700702 2015 Association of differential ?-catenin expression with Oct-4 and Nanog in oral squamous cell carcinoma and their correlation with clinicopathological factors and prognosis.
24694094 2014 Activation of neural cell fate programs toward direct conversion of adult human fibroblasts into tri-potent neural progenitors using OCT-4.
24627557 2014 Induced overexpression of OCT4A in human embryonic stem cells increases cloning efficiency.
24607276 2014 Selective anticancer effects of a synthetic flavagline on human Oct4-expressing cancer stem-like cells via a p38 MAPK-dependent caspase-3-dependent pathway.
24586860 2014 Expression and differentiation between OCT4A and its Pseudogenes in human ESCs and differentiated adult somatic cells.
24581739 2014 An expressed retrogene of the master embryonic stem cell gene POU5F1 is associated with prostate cancer susceptibility.
24568633 2014 Sodium butyrate facilitates reprogramming by derepressing OCT4 transactivity at the promoter of embryonic stem cell-specific miR-302/367 cluster.
24532469 2014 Clinical significance of the stem cell gene Oct-4 in cervical cancer.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24497960 2014 Cobalt and nickel stabilize stem cell transcription factor OCT4 through modulating its sumoylation and ubiquitination.
24481676 2014 OCT3 and SOX2 promote the transformation of Barrett's esophagus to adenocarcinoma by regulating the formation of tumor stem cells.
24481450 2014 Control of glioma cell death and differentiation by PKM2-Oct4 interaction.
24475251 2014 Oct4 mediates tumor initiating properties in oral squamous cell carcinomas through the regulation of epithelial-mesenchymal transition.
24457968 2014 OCT4 as a target of miR-34a stimulates p63 but inhibits p53 to promote human cell transformation.
24450601 2014 Correlation of ALDH1, CD44, OCT4 and SOX2 in tongue squamous cell carcinoma and their association with disease progression and prognosis.
24427323 2014 The expression profile of Oct4 and Sox2 in the carcinogenesis of oral mucosa.
24413464 2014 Novel SCRG1/BST1 axis regulates self-renewal, migration, and osteogenic differentiation potential in mesenchymal stem cells.
24387977 2014 Stem cell profiling in head and neck cancer reveals an Oct-4 expressing subpopulation with properties of chemoresistance.
24386189 2013 POU5F1 enhances the invasiveness of cancer stem-like cells in lung adenocarcinoma by upregulation of MMP-2 expression.
24373696 2014 Developmental patterns of Ki-67, Oct-4 and ?-tubulin proteins expression in the human spinal cord.
24370212 2014 Do all roads lead to Oct4? the emerging concepts of induced pluripotency.
24336974 2014 Expression, purification and characterization of a recombinant Tat47-57-Oct4 fusion protein in Pichia pastoris.
24324071 2013 Suppression of OCT4B enhances sensitivity of lung adenocarcinoma A549 cells to cisplatin via increased apoptosis.
24320714 2014 Expression and prognostic significance of Oct4 and Nanog in neuroblastoma.
24256943 2015 Prerequisite OCT4 Maintenance Potentiates the Neural Induction of Differentiating Human Embryonic Stem Cells and Induced Pluripotent Stem Cells.
24182453 2014 Cytoplasmic OCT4 staining is a sensitive marker of neuroendocrine differentiation.
24145198 2014 OCT4: dynamic DNA binding pioneers stem cell pluripotency.
24105929 2014 Two novel splice variants of SOX2OT, SOX2OT-S1, and SOX2OT-S2 are coupregulated with SOX2 and OCT4 in esophageal squamous cell carcinoma.
24073944 2013 Effect of exogenous Oct4 overexpression on cardiomyocyte differentiation of human amniotic mesenchymal cells.
24070213 2013 Downregulation of KPNA2 in non-small-cell lung cancer is associated with Oct4 expression.
24038750 2014 Oct4 maintains the pluripotency of human embryonic stem cells by inactivating p53 through Sirt1-mediated deacetylation.
23984394 2013 PSCA and Oct-4 expression in the benign and malignant lesions of gallbladder: implication for carcinogenesis, progression, and prognosis of gallbladder adenocarcinoma.
23963638 2013 Sox transcription factors require selective interactions with Oct4 and specific transactivation functions to mediate reprogramming.
23955597 2013 Common variation at 3q26.2, 6p21.33, 17p11.2 and 22q13.1 influences multiple myeloma risk.
23933063 2013 Differential expression of Oct4 variants and pseudogenes in normal urothelium and urothelial cancer.
23932306 2013 Gene expression of stem cells at different stages of ontological human development.
23928699 2013 OCT4 promotes tumorigenesis and inhibits apoptosis of cervical cancer cells by miR-125b/BAK1 pathway.
23921511 2013 Follicle-stimulating hormone inhibits apoptosis in ovarian cancer cells by regulating the OCT4 stem cell signaling pathway.
23917144 2013 Inflammation-related DNA damage and expression of CD133 and Oct3/4 in cholangiocarcinoma patients with poor prognosis.
23887079 2013 Embryonic transcription factors CDX2 and Oct4 are overexpressed in neuroendocrine tumors of the ileum: a pilot study.
23872274 2013 Knockdown of Oct4 and Nanog expression inhibits the stemness of pancreatic cancer cells.
23863554 2014 Merkel cell carcinoma exhibiting cytoplasmic OCT4 staining: a potential new diagnostic immunohistochemical marker.
23828673 The detrimental effects of diabetes on pluripotency determined by KLF4, SOX2, C-MYC and OCT4 immunoreactivity in rat testes.
23736381 2013 Pluripotent stem cell transcription factors during human odontogenesis.
23670345 2013 OCT4 is epigenetically regulated by DNA hypomethylation of promoter and exon in primary gliomas.
23643069 2013 Enrichment in c-Kit+ enhances mesodermal and neural differentiation of human chorionic placental cells.
23636800 2013 Prognostication of OCT4 isoform expression in prostate cancer.
23615404 2013 Pseudogene OCT4-pg4 functions as a natural micro RNA sponge to regulate OCT4 expression by competing for miR-145 in hepatocellular carcinoma.
23613880 2013 Differential expression of ID4 and its association with TP53 mutation, SOX2, SOX4 and OCT-4 expression levels.
23613252 2013 Forced expression of OCT4 influences the expression of pluripotent genes in human mesenchymal stem cells and fibroblasts.
23609451 2013 Increased chemosensitivity via targeting testicular nuclear receptor 4 (TR4)-Oct4-interleukin 1 receptor antagonist (IL1Ra) axis in prostate cancer CD133+ stem/progenitor cells to battle prostate cancer.
23601300 2013 [Correlations between OCT4 expression and clinicopathological factors and prognosis of patients with lung adenocarcinoma].
23594289 2013 Immunohistochemical analysis of the role and relationship between Notch-1 and Oct-4 expression in urinary bladder carcinoma.
23588367 2013 Cytoplasmic staining of OCT4 is a highly sensitive marker of adrenal medullary-derived tissue.
23549118 2013 The interactomes of POU5F1 and SOX2 enhancers in human embryonic stem cells.
23545524 2013 Human organic cation transporters 1 (SLC22A1), 2 (SLC22A2), and 3 (SLC22A3) as disposition pathways for fluoroquinolone antimicrobials.
23541921 2013 Endogenous miRNA sponge lincRNA-RoR regulates Oct4, Nanog, and Sox2 in human embryonic stem cell self-renewal.
23539445 2013 ?-Catenin/POU5F1/SOX2 transcription factor complex mediates IGF-I receptor signaling and predicts poor prognosis in lung adenocarcinoma.
23525564 2013 Downregulation of OCT4 promotes differentiation and inhibits growth of BE (2)-C human neuroblastoma I-type cells.
23499384 2013 Replacement of Oct4 by Tet1 during iPSC induction reveals an important role of DNA methylation and hydroxymethylation in reprogramming.
23438193 2013 Positive correlation of Oct4 and ABCG2 to chemotherapeutic resistance in CD90(+)CD133(+) liver cancer stem cells.
23433354 2013 OCT4 increases BIRC5 and CCND1 expression and promotes cancer progression in hepatocellular carcinoma.
23391989 2013 Expression of Oct4 in human embryonic stem cells is dependent on nanotopographical configuration.
23388106 2013 BAY11 enhances OCT4 synthetic mRNA expression in adult human skin cells.
23349823 2013 Generation and characterisation of cisplatin-resistant non-small cell lung cancer cell lines displaying a stem-like signature.
23340171 2013 Oct-4 is required for an antiapoptotic behavior of chemoresistant colorectal cancer cells enriched for cancer stem cells: effects associated with STAT3/Survivin.
23314702 2013 Breaking through an epigenetic wall: re-activation of Oct4 by KRAB-containing designer zinc finger transcription factors.
23307247 2013 A signature for induced pluripotent stem cell-associated genes in colorectal cancer.
23302226 2013 Cisplatin hypersensitivity of testicular germ cell tumors is determined by high constitutive Noxa levels mediated by Oct-4.
23290742 2013 Expression of the pluripotent transcription factor OCT4 promotes cell migration in endometriosis.
23279472 2012 Canine fibroblasts expressing human transcription factors: what is in the route for the production of canine induced pluripotent stem cells.
23276226 2013 Effects of donor fibroblasts expressing OCT4 on bovine embryos generated by somatic cell nuclear transfer.
23255053 2013 Itch, an E3 ligase of Oct4, is required for embryonic stem cell self-renewal and pluripotency induction.
23213213 2012 Identification of Oct4-activating compounds that enhance reprogramming efficiency.
23211052 2013 Characterization of mesenchymal stem cell subpopulations from human amniotic membrane with dissimilar osteoblastic potential.
23185410 2012 OCT4 positively regulates Survivin expression to promote cancer cell proliferation and leads to poor prognosis in esophageal squamous cell carcinoma.
23136034 2013 MicroRNA-302 increases reprogramming efficiency via repression of NR2F2.
23088399 2013 C-MYC controlled TIP110 protein expression regulates OCT4 mRNA splicing in human embryonic stem cells.
23076549 2013 OCT4 regulates epithelial-mesenchymal transition and its knockdown inhibits colorectal cancer cell migration and invasion.
23052207 2013 MBD6 is a direct target of Oct4 and controls the stemness and differentiation of adipose tissue-derived stem cells.
23041284 2012 Reciprocal regulation of Akt and Oct4 promotes the self-renewal and survival of embryonal carcinoma cells.
23024368 2012 Serine 111 phosphorylation regulates OCT4A protein subcellular distribution and degradation.
23002208 2012 Chemotherapeutic sensitivity of testicular germ cell tumors under hypoxic conditions is negatively regulated by SENP1-controlled sumoylation of OCT4.
23000165 2012 Regulation of OCT4 gene expression by liver receptor homolog-1 in human embryonic carcinoma cells.
22944295 2012 Expression of stem-cell markers OCT-4 and CD133: important prognostic factors in papillary renal cell carcinoma.
22922943 2012 Upregulation and inhibition of the nuclear translocation of Oct4 during multistep gastric carcinogenesis.
22914767 2012 Methylation profile of the promoters of Nanog and Oct4 in ICSI human embryos.
22903480 2012 A plausible anti-apoptotic role of up-regulated OCT4B1 in bladder tumors.
22901285 2012 Protein markers of cancer-associated fibroblasts and tumor-initiating cells reveal subpopulations in freshly isolated ovarian cancer ascites.
22847005 2012 Hyaluronan-CD44v3 interaction with Oct4-Sox2-Nanog promotes miR-302 expression leading to self-renewal, clonal formation, and cisplatin resistance in cancer stem cells from head and neck squamous cell carcinoma.
22844522 2012 Dental pulp stem cells differentiation reveals new insights in Oct4A dynamics.
22837720 2012 Expression of Sox2 and Oct4 and their clinical significance in human non-small-cell lung cancer.
22832160 2012 Transcriptional activation by Oct4 is sufficient for the maintenance and induction of pluripotency.
22824146 2012 Increased expression of OCT4 is associated with low differentiation and tumor recurrence in human hepatocellular carcinoma.
22795133 2012 Oct4 and Nanog directly regulate Dnmt1 to maintain self-renewal and undifferentiated state in mesenchymal stem cells.
22777760 2012 Isolation and characterization of mesenchymal stem cells from whole human umbilical cord applying a single enzyme approach.
22743827 2012 Co-localization of NANOG and OCT4 in human pre-implantation embryos and in human embryonic stem cells.
22727933 2013 Unique kinetics of Oct3/4 microlocalization following dissociation of human embryonic stem cell colonies.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22613719 2012 Generation of induced pluripotent stem cells from human renal proximal tubular cells with only two transcription factors, OCT4 and SOX2.
22588915 2012 [Expression of OCT4 protein in bladder cancer and its clinicopathological implications].
22576801 2012 Oct4 and Sox2 are overexpressed in human neuroblastoma and inhibited by chemotherapy.
22528324 2012 Genetic variations in stem cell-related genes and colorectal cancer prognosis.
22506928 2013 Usefulness of OCT4/3 immunostain in pediatric malignant germ cell tumors.
22482508 2012 Distinct lineage specification roles for NANOG, OCT4, and SOX2 in human embryonic stem cells.
22474382 2012 Phosphorylation regulates human OCT4.
22448662 2012 Diagnostic utility of CD117, CD133, SALL4, OCT4, TCL1 and glypican-3 in malignant germ cell tumors of the ovary.
22446105 2012 Squelching of ETS2 transactivation by POU5F1 silences the human chorionic gonadotropin CGA subunit gene in human choriocarcinoma and embryonic stem cells.
22429998 2012 Inhibition of LDH-A by lentivirus-mediated small interfering RNA suppresses intestinal-type gastric cancer tumorigenicity through the downregulation of Oct4.
22396540 2012 Meiotic competent human germ cell-like cells derived from human embryonic stem cells induced by BMP4/WNT3A signaling and OCT4/EpCAM (epithelial cell adhesion molecule) selection.
22393366 2012 Transcriptome and network changes in climbers at extreme altitudes.
22392999 2012 Wnt/?-catenin signaling promotes differentiation, not self-renewal, of human embryonic stem cells and is repressed by Oct4.
22378186 2012 Tumorigenicity of cancer stem-like cells derived from hepatocarcinoma is regulated by microRNA-145.
22363145 2012 Expression of OCT4 in human esophageal squamous cell carcinoma is significantly associated with poorer prognosis.
22340650 2011 [Altered expressions of embryonic stem-related genes in pancreatic cancer stem cell].
22311737 2012 CD49f enhances multipotency and maintains stemness through the direct regulation of OCT4 and SOX2.
22301499 2012 Expression of OCT3/4 in renal medullary carcinoma represents a potential diagnostic pitfall.
22300949 2012 Clinicopathological significance of non-small cell lung cancer with high prevalence of Oct-4 tumor cells.
22286766 2012 Acquired cancer stem cell phenotypes through Oct4-mediated dedifferentiation.
22252524 2012 Synergistic effect of SCF and G-CSF on stem-like properties in prostate cancer cell lines.
22247013 2012 The novel function of OCT4B isoform-265 in genotoxic stress.
22207173 2012 Co-expression of Oct-4 and Nestin in human breast cancers.
22160855 2012 Comparative epigenetic analysis of Oct4 regulatory region in RA-induced differentiated NT2 cells under adherent and non-adherent culture conditions.
22037460 2011 Oct4-related cytokine effects regulate tumorigenic properties of colorectal cancer cells.
22014056 2011 Expression profile of embryonic stem cell-associated genes Oct4, Sox2 and Nanog in human gliomas.
21987575 2011 Glioma-initiating cells retain their tumorigenicity through integration of the Sox axis and Oct4 protein.
21962512 2011 A DNA repair complex functions as an Oct4/Sox2 coactivator in embryonic stem cells.
21960344 2011 Genome-wide analysis of OCT4 binding sites in glioblastoma cancer cells.
21951846 2011 Nitrative DNA damage and Oct3/4 expression in urinary bladder cancer with Schistosoma haematobium infection.
21947321 2012 Hypoxia induces CD133 expression in human lung cancer cells by up-regulation of OCT3/4 and SOX2.
21946204 2011 [Correlation between expression of HIF-2? and OCT-4 and prognosis of NSCLC].
21938739 2012 Oct-3/4 promotes migration and invasion of glioblastoma cells.
21912425 2013 A whole-genome association study of major determinants for allopurinol-related Stevens-Johnson syndrome and toxic epidermal necrolysis in Japanese patients.
21900452 2012 Hypoxia modulates the undifferentiated phenotype of human renal inner medullary CD133+ progenitors through Oct4/miR-145 balance.
21868340 2011 [Expressions of OCT4 and CD133 and their correlation in colonic cancer].
21852325 2011 Pluripotency-associated stem cell marker expression in proliferative cell cultures derived from adult human pancreas.
21844352 2011 OCT4 establishes and maintains nucleosome-depleted regions that provide additional layers of epigenetic regulation of its target genes.
21828274 2011 HEB and E2A function as SMAD/FOXH1 cofactors.
21804543 2011 FOXO1 is an essential regulator of pluripotency in human embryonic stem cells.
21801394 2011 Genome-wide association study of Stevens-Johnson Syndrome and Toxic Epidermal Necrolysis in Europe.
21798248 2011 Downregulation of transcription factor Oct4 induces an epithelial-to-mesenchymal transition via enhancement of Ca2+ influx in breast cancer cells.
21725800 2012 Expression analysis of stem cell-related genes reveal OCT4 as a predictor of poor clinical outcome in medulloblastoma.
21692598 Undifferentiated gonadal tissue, Y chromosome instability, and tumors in XY gonadal dysgenesis.
21684074 2011 OCT4B1, a novel spliced variant of OCT4, generates a stable truncated protein with a potential role in stress response.
21674242 2011 Differential expression of Oct4 in HPV-positive and HPV-negative cervical cancer cells is not regulated by DNA methyltransferase 3A.
21631526 2011 Expression and interdependencies of pluripotency factors LIN28, OCT3/4, NANOG and SOX2 in human testicular germ cells and tumours of the testis.
21602158 2011 [Expression of Oct-4 transcription factor in squamous cell skin carcinoma and seborrheic keratosis].
21602143 2011 [Small interfering RNA-mediated OCT4 gene silencing inhibits the proliferation and induces apoptosis of pancreatic cancer cell line PANC1].
21559451 2011 Nocodazole treatment decreases expression of pluripotency markers Nanog and Oct4 in human embryonic stem cells.
21547540 2011 Over-expression of Oct4 in human esophageal squamous cell carcinoma.
21533858 2012 Implications of transcriptional factor, OCT-4, in human bladder malignancy and tumor recurrence.
21496429 2011 [miR-145 inhibits lung adenocarcinoma stem cells proliferation by targeting OCT4 gene].
21480394 2012 OCT4 spliced variant OCT4B1 is expressed in human colorectal cancer.
21479367 2011 microRNA-145 suppresses lung adenocarcinoma-initiating cell proliferation by targeting OCT4.
21419292 2011 Expression pattern of Oct-4, Sox2, and c-Myc in the primary culture of human dental pulp derived cells.
21403679 2011 Oct-4+/Tenascin C+ neuroblastoma cells serve as progenitors of tumor-derived endothelial cells.
21394007 2011 Clinical implications of stem cell gene Oct-4 expression in breast cancer.
21376027 2011 Role of Sox2 and Oct4 in predicting survival of hepatocellular carcinoma patients after hepatectomy.
21365617 2011 Up-regulation of microRNA-145 promotes differentiation by repressing OCT4 in human endometrial adenocarcinoma cells.
21323541 2011 Risk HLA-DQA1 and PLA(2)R1 alleles in idiopathic membranous nephropathy.
21301344 2011 A case-control study on the rs3130932 single nucleotide polymorphism in the OCT4B translation initiation codon in association with cancer state.
21273125 2011 New candidate gene POU5F1 associated with premature ovarian failure in Chinese patients.
21262915 2011 Activation of the aryl hydrocarbon receptor AhR Promotes retinoic acid-induced differentiation of myeloblastic leukemia cells by restricting expression of the stem cell transcription factor Oct4.
21227461 2012 Role of the stemness factors sox2, oct3/4, and nanog in gastric carcinoma.
21166886 2010 Ascorbic acid induces in vitro proliferation of human subcutaneous adipose tissue derived mesenchymal stem cells with upregulation of embryonic stem cell pluripotency markers Oct4 and SOX 2.
21159654 2010 Coexpression of Oct4 and Nanog enhances malignancy in lung adenocarcinoma by inducing cancer stem cell-like properties and epithelial-mesenchymal transdifferentiation.
21151833 2010 Transcriptional regulation of Oct4 by a long non-coding RNA antisense to Oct4-pseudogene 5.
21151097 2011 A regulatory circuitry comprised of miR-302 and the transcription factors OCT4 and NR2F2 regulates human embryonic stem cell differentiation.
21135096 2011 Nuclear orphan receptor TLX induces Oct-3/4 for the survival and maintenance of adult hippocampal progenitors upon hypoxia.
21107090 2010 Oct4 expression in immature teratoma of the ovary: relevance to histologic grade and degree of differentiation.
20981110 2011 Transient expression of OCT4 is sufficient to allow human keratinocytes to change their differentiation pathway.
20958186 2010 Human corneal basal epithelial cells express an embryonic stem cell marker OCT4.
20953172 2010 A genome-wide RNAi screen reveals determinants of human embryonic stem cell identity.
20942235 2010 [Significance of Oct-4's expression in thyroid neoplasm].
20937145 2010 Prognostic significance of Oct4 and Sox2 expression in hypopharyngeal squamous cell carcinoma.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20879854 2011 Pluripotency regulators in human mesenchymal stem cells: expression of NANOG but not of OCT-4 and SOX-2.
20858707 2010 Selective transport of monoamine neurotransmitters by human plasma membrane monoamine transporter and organic cation transporter 3.
20824712 2011 OCT4B1, a novel spliced variant of OCT4, is highly expressed in gastric cancer and acts as an antiapoptotic factor.
20818602 2010 The expression of stem cell-related indicators as a prognostic factor in human lung adenocarcinoma.
20805580 2010 Newer insights into premeiotic development of germ cells in adult human testis using Oct-4 as a stem cell marker.
20736927 2010 Oct-3/4 regulates stem cell identity and cell fate decisions by modulating Wnt/?-catenin signalling.
20721963 2010 Atypical expression and distribution of embryonic stem cell marker, OCT4, in human lung adenocarcinoma.
20713518 2010 Foxp1 coordinates cardiomyocyte proliferation through both cell-autonomous and nonautonomous mechanisms.
20698766 2010 Generation of human-induced pluripotent stem cells from gut mesentery-derived cells by ectopic expression of OCT4/SOX2/NANOG.
20662612 2010 Comparative study of stemness characteristics of mesenchymal cells from bone marrow of children and adults.
20647538 2010 Single-molecule analysis reveals changes in the DNA replication program for the POU5F1 locus upon human embryonic stem cell differentiation.
20604894 2010 Comparison of MHC class I risk haplotypes in Thai and Caucasian psoriatics shows locus heterogeneity at PSORS1.
20594032 2011 Transcriptional regulation of oct4 in human bone marrow mesenchymal stem cells.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20526341 2010 Transposable elements have rewired the core regulatory network of human embryonic stem cells.
20510497 Rapid and efficient reprogramming of human amnion-derived cells into pluripotency by three factors OCT4/SOX2/NANOG.
20505821 2010 A novel SALL4/OCT4 transcriptional feedback network for pluripotency of embryonic stem cells.
20505756 2010 A data integration approach to mapping OCT4 gene regulatory networks operative in embryonic stem cells and embryonal carcinoma cells.
20497257 2011 Histone methylation is a critical regulator of the abnormal expression of POU5F1 and RASSF1A in testis cancer cell lines.
20477760 2010 A role for the Werner syndrome protein in epigenetic inactivation of the pluripotency factor Oct4.
20462980 2010 Prognostic significance of OCT4 expression in adenocarcinoma of the lung.
20458727 2010 Expression profile of the embryonic markers nanog, OCT-4, SSEA-1, SSEA-4, and frizzled-9 receptor in human periodontal ligament mesenchymal stem cells.
20433421 2011 Oct-4B isoform is differentially expressed in breast cancer cells: hypermethylation of regulatory elements of Oct-4A suggests an alternative promoter and transcriptional start site for Oct-4B transcription.
20412747 2010 [The dual role of OCT4].
20412569 2010 OCT-4 expression in follicular and luteal phase endometrium: a pilot study.
20404147 2010 Natural immunity to pluripotency antigen OCT4 in humans.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20356403 2010 Human haematopoietic stem cells express Oct4 pseudogenes and lack the ability to initiate Oct4 promoter-driven gene expression.
20347080 2010 OCT4 gonadal gene expression related to the presence of Y-chromosome sequences in Turner syndrome.
20333750 2010 Concise review: isoforms of OCT4 contribute to the confusing diversity in stem cell biology.
20230781 2010 Mapping of the minimal internal ribosome entry site element in the human embryonic stem cell gene OCT4B mRNA.
20224970 2010 Human embryonic stem cells from aneuploid blastocysts identified by pre-implantation genetic screening.
20224565 2010 A protocol describing the genetic correction of somatic human cells and subsequent generation of iPS cells.
20203285 2010 Function of EWS-POU5F1 in sarcomagenesis and tumor cell maintenance.
20173672 2010 Oct4 and Nanog expression is associated with early stages of pancreatic carcinogenesis.
20171362 2010 Side population increase after simulated transient ischemia in human dental pulp cell.
20139178 2010 Upregulation of Oct-4 isoforms in pulmonary artery smooth muscle cells from patients with pulmonary arterial hypertension.
20123703 2010 OCT4 and downstream factors are expressed in human somatic urogenital epithelia and in culture of epididymal spheres.
20103622 2010 Novel candidate cancer genes identified by a large-scale cross-species comparative oncogenomics approach.
20101213 2010 Pluripotency factors Lin28 and Oct4 identify a sub-population of stem cell-like cells in ovarian cancer.
20074550 2010 Wnt/beta-catenin signaling regulates cancer stem cells in lung cancer A549 cells.
20054811 2010 Transcriptional regulation of the Oct4 gene, a master gene for pluripotency.
20051954 2010 EWS-Oct-4B, an alternative EWS-Oct-4 fusion gene, is a potent oncogene linked to human epithelial tumours.
20038322 2010 [OCT4 expression in hepatocellular carcinoma and its clinical significance].
20034424 2009 Role of Oct-4 during acquisition of developmental competence in mouse oocyte.
20027182 2010 Reprogramming towards pluripotency requires AID-dependent DNA demethylation.
19969351 2010 Relationships between multidrug resistance (MDR) and stem cell markers in human chronic myeloid leukemia cell lines.
19968627 2010 Oct-4 controls cell-cycle progression of embryonic stem cells.
19966271 2010 Lin28-mediated post-transcriptional regulation of Oct4 expression in human embryonic stem cells.
19898493 2009 Direct cell reprogramming is a stochastic process amenable to acceleration.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19816951 2009 Klf4 interacts directly with Oct4 and Sox2 to promote reprogramming.
19777066 2009 Regulation of adipose tissue stromal cells behaviors by endogenic Oct4 expression control.
19751112 2009 BMP-11 and myostatin support undifferentiated growth of human embryonic stem cells in feeder-free cultures.
19736317 2009 Interplay of Oct4 with Sox2 and Sox17: a molecular switch from stem cell pluripotency to specifying a cardiac fate.
19718018 2009 Direct reprogramming of human neural stem cells by OCT4.
19696409 2009 iPS programmed without c-MYC yield proficient cardiogenesis for functional heart chimerism.
19657699 2009 Correlation of CD133, OCT4, and SOX2 in rectal cancer and their association with distant recurrence after chemoradiotherapy.
19559696 2009 Mesenchymal to embryonic incomplete transition of human cells by chimeric OCT4/3 (POU5F1) with physiological co-activator EWS.
19549847 2009 Stoichiometric and temporal requirements of Oct4, Sox2, Klf4, and c-Myc expression for efficient human iPSC induction and differentiation.
19536159 2009 The pluripotency factor Oct4 interacts with Ctcf and also controls X-chromosome pairing and counting.
19489092 2009 Alternative translation of OCT4 by an internal ribosome entry site and its novel function in stress response.
19483629 2009 Embryonic stem cell transcription factors and D2-40 (podoplanin) as diagnostic immunohistochemical markers in ovarian germ cell tumors.
19458492 2009 Genes involved in regulation of stem cell properties: studies on their expression in a small cohort of neuroblastoma patients.
19445899 2009 Implication of human OCT4 transactivation domains for self-regulatory transcription.
19438894 2009 Oct-4A isoform is expressed in human cord blood-derived CD133 stem cells and differentiated progeny.
19414369 2009 Oct3/4 and Sox2 are significantly associated with an unfavorable clinical outcome in human esophageal squamous cell carcinoma.
19409607 2009 MicroRNA-145 regulates OCT4, SOX2, and KLF4 and represses pluripotency in human embryonic stem cells.
19396148 2009 Testicular mixed germ cell tumors: a morphological and immunohistochemical study using stem cell markers, OCT3/4, SOX2 and GDF3, with emphasis on morphologically difficult-to-classify areas.
19394308 2009 OCT4A contributes to the stemness and multi-potency of human umbilical cord blood-derived multipotent stem cells (hUCB-MSCs).
19383152 2009 O-GlcNAc modifications regulate cell survival and epiboly during zebrafish development.
19350677 2009 Specific knockdown of OCT4 in human embryonic stem cells by inducible short hairpin RNA interference.
19347886 2009 Oct4, a novel marker for human gastric cancer.
19327014 2009 A method for isolating pluripotent/multipotent stem cells from blood by using the pluripotent and germ-line DAZL gene as a marker.
19274762 2009 The expression of pluripotency marker Oct 3/4 in prostate cancer and benign prostate hyperplasia.
19274063 2009 WWP2 promotes degradation of transcription factor OCT4 in human embryonic stem cells.
19271143 2009 Involvement of the organic cation transporters in histamine uptake into human vascular endothelial cells.
19224238 2009 Oct4 is expressed in Nestin-positive cells as a marker for pancreatic endocrine progenitor.
19224167 2009 Expression of transcription factor Oct4 in bladder cancer cell line T24 and its effects on the biological characteristics of the cells.
19203577 2009 Oct4-induced pluripotency in adult neural stem cells.
19171782 2009 A general mechanism for transcription regulation by Oct1 and Oct4 in response to genotoxic and oxidative stress.
19170206 2009 Mutation in the DNA-binding domain of the EWS-Oct-4 oncogene results in dominant negative activity that interferes with EWS-Oct-4-mediated transactivation.
19126554 2009 OCT4 expression in human non-small cell lung cancer: implications for therapeutic intervention.
19103427 2008 Identification of karyopherin-alpha 2 as an Oct4 associated protein.
19102659 2009 Effects of ectopic Nanog and Oct4 overexpression on mesenchymal stem cells.
19058139 2009 Oct4A is expressed by a subpopulation of prostate neuroendocrine cells.
19023518 2009 Analysis of OCT4 expression in an extended panel of human tumor cell lines from multiple entities and in human mesenchymal stem cells.
18985733 2009 Oct4 is expressed in human gliomas and promotes colony formation in glioma cells.
18957414 2008 Esrrb activates Oct4 transcription and sustains self-renewal and pluripotency in embryonic stem cells.
18946985 [Identification of the OCT4-pg1 retrogene and NANOG gene expression in the human embryonic eye].
18818365 2008 Induced pluripotent stem cells generated without viral integration.
18810488 2008 Epigenetic deregulation of the human Oct4 promoter in mouse cells.
18806776 2008 MicroRNAs to Nanog, Oct4 and Sox2 coding regions modulate embryonic stem cell differentiation.
18787205 2008 OCT4 spliced variants are differentially expressed in human pluripotent and nonpluripotent cells.
18765667 2008 Novel variants of Oct-3/4 gene expressed in mouse somatic cells.
18710938 2008 Oct4/Sox2-regulated miR-302 targets cyclin D1 in human embryonic stem cells.
18676852 2008 Oct-3/4 expression reflects tumor progression and regulates motility of bladder cancer cells.
18617685 2008 In vivo osteoprogenitor potency of human stromal cells from different tissues does not correlate with expression of POU5F1 or its pseudogenes.
18612434 2008 Oct-4 expression maintained cancer stem-like properties in lung cancer-derived CD133-positive cells.
18594515 2008 Pluripotent stem cells induced from adult neural stem cells by reprogramming with two factors.
18593985 2008 Positive correlations of Oct-4 and Nanog in oral cancer stem-like cells and high-grade oral squamous cell carcinoma.
18467432 2008 Differential expression of the embryo/cancer gene ECSA(DPPA2), the cancer/testis gene BORIS and the pluripotency structural gene OCT4, in human preimplantation development.
18440631 2008 Oct4 is epigenetically regulated by methylation in normal placenta and gestational trophoblastic disease.
18439155 2008 Immunohistochemical localization of nanog and Oct4 in stem cell compartments of human sacrococcygeal teratomas.
18388306 2008 Regulation of self-renewal and pluripotency by Sox2 in human embryonic stem cells.
18366076 2008 Identification of DPPA4 and other genes as putative Sox2:Oct-3/4 target genes using a combination of in silico analysis and transcription-based assays.
18338169 2008 Simultaneous expression of Oct4 and genes of three germ layers in single cell-derived multipotent adult progenitor cells.
18295396 2008 Participation of OCT3/4 and beta-catenin during dysgenetic gonadal malignant transformation.
18281244 2008 Presumed pluripotency markers UTF-1 and REX-1 are expressed in human adult testes and germ cell neoplasms.
18269588 2008 Independent prognostic value of the basal-like phenotype of breast cancer and associations with EGFR and candidate stem cell marker BMI-1.
18254969 2008 Sequence variation in the human transcription factor gene POU5F1.
18231740 2007 Expression and significance of Oct4 in bladder cancer.
18199879 2008 The early human germ cell lineage does not express SOX2 during in vivo development or upon in vitro culture.
18191611 2008 Pyruvate kinase isozyme type M2 (PKM2) interacts and cooperates with Oct-4 in regulating transcription.
18157115 2008 Reprogramming of human somatic cells to pluripotency with defined factors.
18088417 2007 Conserved and divergent patterns of expression of DAZL, VASA and OCT4 in the germ cells of the human fetal ovary and testis.
18035408 2007 Induction of pluripotent stem cells from adult human fibroblasts by defined factors.
18032701 2008 Absence of OCT4 expression in somatic tumor cell lines.
18029452 2007 Induced pluripotent stem cell lines derived from human somatic cells.
18000303 2007 Evidence for the presence of stem cell-like progenitor cells in human adult pancreas.
17982423 2007 Stem cell markers in the human posterior limbus and corneal endothelium of unwounded and wounded corneas.
17959850 2007 Manipulation of OCT4 levels in human embryonic stem cells results in induction of differential cell types.
17923501 2007 A novel subset of putative stem/progenitor CD34+Oct-4+ cells is the major target for SARS coronavirus in human lung.
17761754 2007 Functional similarities among genes regulated by OCT4 in human mesenchymal and embryonic stem cells.
17682839 2007 Aberrant expression and distribution of the OCT-4 transcription factor in seminomas.
17573914 2008 Differentiation of human embryonic stem cells induces condensation of chromosome territories and formation of heterochromatin protein 1 foci.
17554336 2007 In vitro reprogramming of fibroblasts into a pluripotent ES-cell-like state.
17549357 2007 Differential methylation of the OCT3/4 upstream region in primary human testicular germ cell tumors.
17525163 2007 Sumoylation of Oct4 enhances its stability, DNA binding, and transactivation.
17506876 2007 Silencing of core transcription factors in human EC cells highlights the importance of autocrine FGF signaling for self-renewal.
17413979 2007 Carcinomas of ovary and lung with clear cell features: can immunohistochemistry help in differential diagnosis?
17409736 2006 Isolation and characterization of a population of immature dental pulp stem cells expressing OCT-4 and other embryonic stem cell markers.
17390031 2007 Conserved POU/OCT- and GATA-binding sites in 5'-flanking promoter region of mammalian WNT8B orthologs.
17379765 2007 Oct-4 expression in adult human differentiated cells challenges its role as a pure stem cell marker.
17314394 2007 Epigenetic reprogramming of OCT4 and NANOG regulatory regions by embryonal carcinoma cell extract.
17314032 2007 The genetic polymorphisms of POU5F1 gene are associated with psoriasis vulgaris in Chinese.
17273778 2007 Conserved POU-binding site linked to SP1-binding site within FZD5 promoter: Transcriptional mechanisms of FZD5 in undifferentiated human ES cells, fetal liver/spleen, adult colon, pancreatic islet, and diffuse-type gastric cancer.
17245123 2007 Oct-3/4: not just a gatekeeper of pluripotency for embryonic stem cell, a cell fate instructor through a gene dosage effect.
17226773 2007 Transcriptional regulation of human Oct4 by steroidogenic factor-1.
17211834 2007 Oct-4, Rex-1, and Gata-4 expression in human MSC increase the differentiation efficiency but not hTERT expression.
17205510 2007 OCT-4, an embryonic stem cell marker, is highly expressed in bladder cancer.
17136117 2007 Morphological and molecular characterization of novel population of CXCR4+ SSEA-4+ Oct-4+ very small embryonic-like cells purified from human cord blood: preliminary report.
17093407 2006 A protein interaction network for pluripotency of embryonic stem cells.
17068183 2007 Analysis of Oct4-dependent transcriptional networks regulating self-renewal and pluripotency in human embryonic stem cells.
17011492 2006 Oct-3/4 dose dependently regulates specification of embryonic stem cells toward a cardiac lineage and early heart development.
16951404 2006 The human OCT-4 isoforms differ in their ability to confer self-renewal.
16916925 2006 POU5F1 isoforms show different expression patterns in human embryonic stem cells and preimplantation embryos.
16892178 2006 Differentiation of human embryonic stem cells into hepatocytes in 2D and 3D culture systems in vitro.
16702430 2006 Rapid evolution of major histocompatibility complex class I genes in primates generates new disease alleles in humans via hitchhiking diversity.
16557044 2006 Loss of Oct-3/4 expression in embryonal carcinoma cells is associated with induction of cisplatin resistance.
16421218 2006 Oct-4 expression in human endometrium.
16229821 2005 Oct4 pseudogenes are transcribed in cancers.
16153702 2005 Core transcriptional regulatory circuitry in human embryonic stem cells.
16149048 2005 Characterization of putative cis-regulatory elements that control the transcriptional activity of the human Oct4 promoter.
15917470 Stimulation of Oct-4 activity by Ewing's sarcoma protein.
15790780 2005 Human bone marrow mesenchymal stem cells can express insulin and key transcription factors of the endocrine pancreas developmental pathway upon genetic and/or microenvironmental manipulation in vitro.
15749924 2005 High-efficiency RNA interference in human embryonic stem cells.
15729702 2005 EWSR1 is fused to POU5F1 in a bone tumor with translocation t(6;22)(p21;q12).
15695770 2005 Oct-4 mRNA and protein expression during human preimplantation development.
15625129 2005 Stably transfected human embryonic stem cell clones express OCT4-specific green fluorescent protein and maintain self-renewal and pluripotency.
15615706 2005 Sequential DNA methylation of the Nanog and Oct-4 upstream regions in human NT2 cells during neuronal differentiation.
15513931 2005 Oct4 expression in adult human stem cells: evidence in support of the stem cell theory of carcinogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467907 2004 Expression of transcription factor Oct-4 and other embryonic genes in CD133 positive cells from human umbilical cord blood.
15342930 2004 Specific knockdown of Oct4 and beta2-microglobulin expression by RNA interference in human embryonic stem cells and embryonic carcinoma cells.
15105401 2004 Developmental expression of POU5F1 (OCT-3/4) in normal and dysgenetic human gonads.
15047715 2004 Wwp2, an E3 ubiquitin ligase that targets transcription factor Oct-4 for ubiquitination.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12923055 2003 Crystal structure of a POU/HMG/DNA ternary complex suggests differential assembly of Oct4 and Sox2 on two enhancers.
12841847 2003 The POU homeodomain protein OCT3 as a potential transcriptional activator for fibroblast growth factor-4 (FGF-4) in human breast cancer cells.
12727846 2003 POU5F1 (OCT3/4) identifies cells with pluripotent potential in human germ cell tumors.
12653732 2003 A study of candidate genes for psoriasis near HLA-C in Chinese patients with psoriasis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11891324 2002 The embryonic stem cell transcription factors Oct-4 and FoxD3 interact to regulate endodermal-specific promoter expression.
11689681 2001 Repression of Ets-2-induced transactivation of the tau interferon promoter by Oct-4.
10742100 2000 Quantitative expression of Oct-3/4 defines differentiation, dedifferentiation or self-renewal of ES cells.
10082529 1999 Synergism with germ line transcription factor Oct-4: viral oncoproteins share the ability to mimic a stem cell-specific activity.
9814708 1998 Formation of pluripotent stem cells in the mammalian embryo depends on the POU transcription factor Oct4.
9368058 1997 The cyclin-dependent kinase-activating kinase (CAK) assembly factor, MAT1, targets and enhances CAK activity on the POU domains of octamer transcription factors.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8567814 1995 Expression of transcription regulating genes in human preimplantation embryos.
8500351 1993 In situ hybridization localizes the human OTF3 to chromosome 6p21.3-->p22 and OTF3L to 12p13.
8088794 1994 Localization of the OTF3 gene within the human MHC class I region by physical and meiotic mapping.
7908264 1994 A human POU domain gene, mPOU, is expressed in developing brain and specific adult tissues.
1723621 1991 Octamer-dependent regulation of the kFGF gene in embryonal carcinoma and embryonic stem cells.
1408763 1992 Human Oct3 gene family: cDNA sequences, alternative splicing, gene organization, chromosomal location, and expression at low levels in adult tissues.