Property Summary

NCBI Gene PubMed Count 29
PubMed Score 143.79
PubTator Score 75.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 3.200 7.8e-07
osteosarcoma -1.221 3.6e-04
atypical teratoid / rhabdoid tumor 1.500 2.9e-02
sonic hedgehog group medulloblastoma 2.700 1.3e-02
medulloblastoma, large-cell 2.300 7.2e-03
lung cancer 3.100 1.7e-03

Gene RIF (13)

PMID Text
23666755 Brn3a cooperates with activated RAS/RAF signalling by reducing oncogene-induced senescence in melanocytic tumourigenesis.
22930747 Data indicate that median methylation levels of BCAN, HOXD1, KCTD8, KLF11, NXPH1, POU4F1, SIM1, and TCF7L1 were >/=30% higher than in normal samples, representing potential biomarkers for tumor diagnosis.
22064348 PoU4F1 is highly expressed in t(8;21) samples, with AML/ETO appearning to promote some BRN3A expression
21928122 BRN3A possesses anti-apoptotic property, and considering the above results, it may be regarded as the key component in promoting tumorigenic growth in the uterine cervical cells.
20376082 Dysregulation of POU4F1 is associated with t(8;21) acute myeloid leukemia.
20348952 Ewing sarcoma induce expression of neuronal markers such as BRN3A showing that the function of those same markers may be restricted or controlled in an sarcoma-dependent manner.
16276351 Upregulation of Brn-3a is associated with prostate cancer
16247485 Brn-3a has a role in differential regulation of different human papilloma virus variants
15272315 Hsp27 expression and cell survival are regulated by the POU transcription factor Brn3a
15021903 oncogenic rearrangement of EWS to produce EWS/Fli-1 may enhance the antiapoptotic effect of Brn-3a and inhibit its ability to promote neuronal differentiation.
12911730 These results indicate that Brn-3a could play an important role in the near future in improving cervical cancer screening.
12893201 Measurement of Brn-3a levels in smears can be used to detect a significant proportion of cervical lesions that were missed by Pap smear.
12427558 genomic organization of the Brn-3a locus and the mechanisms that control the expression of two different proteins from one genomic locus

AA Sequence

MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEALAAVDIAVSQ      1 - 70
GKSHPFKPDATYHTMNSVPCTSTSTVPLAHHHHHHHHHQALEPGDLLDHISSPSLALMAGAGGAGAAAGG     71 - 140
GGAHDGPGGGGGPGGGGGPGGGPGGGGGGGPGGGGGGPGGGLLGGSAHPHPHMHSLGHLSHPAAAAAMNM    141 - 210
PSGLPHPGLVAAAAHHGAAAAAAAAAAGQVAAASAAAAVVGAAGLASICDSDTDPRELEAFAERFKQRRI    211 - 280
KLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMNKPELF    281 - 350
NGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY     351 - 419
//

Text Mined References (30)

PMID Year Title
23805044 2013 RIT2, a neuron-specific small guanosine triphosphatase, is expressed in retinal neuronal cells and its promoter is modulated by the POU4 transcription factors.
23666755 2013 The neural crest transcription factor Brn3a is expressed in melanoma and required for cell cycle progression and survival.
22930747 2012 Genome-wide methylation screen in low-grade breast cancer identifies novel epigenetically altered genes as potential biomarkers for tumor diagnosis.
22064348 2012 AML1/ETO and POU4F1 synergy drives B-lymphoid gene expression typical of t(8;21) acute myeloid leukemia.
21928122 2011 Molecular analysis of oncogenicity of the transcription factor, BRN3A, in cervical cancer cells.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
20376082 2010 POU4F1 is associated with t(8;21) acute myeloid leukemia and contributes directly to its unique transcriptional signature.
20348952 2010 EWS/ETS proteins promote expression and regulate function of the homeodomain transcription factor BRN3A.
17239249 2007 POU-domain factor Brn3a regulates both distinct and common programs of gene expression in the spinal and trigeminal sensory ganglia.
16276351 2006 Brn-3a neuronal transcription factor functional expression in human prostate cancer.
16247485 2006 Differential regulation of different human papilloma virus variants by the POU family transcription factor Brn-3a.
15272315 2004 Regulation of Hsp27 expression and cell survival by the POU transcription factor Brn3a.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
15021903 2004 The effects of Brn-3a on neuronal differentiation and apoptosis are differentially modulated by EWS and its oncogenic derivative EWS/Fli-1.
12934100 2003 Functional interaction between the small GTP-binding protein Rin and the N-terminal of Brn-3a transcription factor.
12911730 Detection of cervical neoplasia using measurement of Brn-3a in cervical smears with persistent minor abnormality.
12893201 2003 Measurement of Brn-3a levels in Pap smears provides a novel diagnostic marker for the detection of cervical neoplasia.
12810599 2003 Brn3a regulation of TrkA/NGF receptor expression in developing sensory neurons.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12441296 2003 Direct autoregulation and gene dosage compensation by POU-domain transcription factor Brn3a.
12432261 The pro-oncoprotein EWS (Ewing's Sarcoma protein) interacts with the Brn-3a POU transcription factor and inhibits its ability to activate transcription.
12427558 2002 Gene expression of the POU factor Brn-3a is regulated by two different promoters.
9448000 1998 POU transcription factors Brn-3a and Brn-3b interact with the estrogen receptor and differentially regulate transcriptional activity via an estrogen response element.
8995448 1997 Inhibition of neuronal process outgrowth and neuronal specific gene activation by the Brn-3b transcription factor.
8941380 1996 The Brn-3a transcription factor gene (POU4F1) maps close to the locus for the variant late infantile form of neuronal ceroid-lipofuscinosis.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8248179 1993 Brn-3.0: a POU-domain protein expressed in the sensory, immune, and endocrine systems that functions on elements distinct from known octamer motifs.
8234287 1993 Differential expression of four members of the POU family of proteins in activated and phorbol 12-myristate 13-acetate-treated Jurkat T cells.
7623109 1995 The Brn-3 family of POU-domain factors: primary structure, binding specificity, and expression in subsets of retinal ganglion cells and somatosensory neurons.
1357630 1992 A novel POU homeodomain gene specifically expressed in cells of the developing mammalian nervous system.