Property Summary

NCBI Gene PubMed Count 13
PubMed Score 129.34
PubTator Score 82.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma -4.900 4.1e-09
medulloblastoma, large-cell -2.900 1.7e-02
Breast cancer -1.700 3.9e-16
psoriasis -1.200 1.3e-30
facioscapulohumeral dystrophy 2.800 1.1e-04

 GO Component (1)

Gene RIF (3)

PMID Text
26510906 Data show that the long noncoding RNA encoded by a gene next to POU3F3 (linc-POU3F3) is a potential therapeutic target and novel molecular biomarker for colorectal cancer (CRC).
25445282 linc-POU3F3 might affect glioma development via altering expression level of POU3F3, and may also have a crucial regulatory role in glioma progression
24631494 Long intergenic non-protein coding RNA POU3F3 contributes to the development of ESCC by interacting with EZH2 to promote methylation of POU3F3, which encodes a transcription factor.

AA Sequence

MATAASNPYLPGNSLLAAGSIVHSDAAGAGGGGGGGGGGGGGGAGGGGGGMQPGSAAVTSGAYRGDPSSV      1 - 70
KMVQSDFMQGAMAASNGGHMLSHAHQWVTALPHAAAAAAAAAAAAVEASSPWSGSAVGMAGSPQQPPQPP     71 - 140
PPPPQGPDVKGGAGRDDLHAGTALHHRGPPHLGPPPPPPHQGHPGGWGAAAAAAAAAAAAAAAAHLPSMA    141 - 210
GGQQPPPQSLLYSQPGGFTVNGMLSAPPGPGGGGGGAGGGAQSLVHPGLVRGDTPELAEHHHHHHHHAHP    211 - 280
HPPHPHHAQGPPHHGGGGGGAGPGLNSHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTL    281 - 350
YGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGA    351 - 420
LESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVGTVSADTPP    421 - 490
PHHGLQTSVQ                                                                491 - 500
//

Text Mined References (14)

PMID Year Title
26510906 2016 Knockdown of linc-POU3F3 suppresses the proliferation, apoptosis, and migration resistance of colorectal cancer.
25445282 2015 Functional linc-POU3F3 is overexpressed and contributes to tumorigenesis in glioma.
24631494 2014 Increased levels of the long intergenic non-protein coding RNA POU3F3 promote DNA methylation in esophageal squamous cell carcinoma cells.
24550763 2014 A de novo POU3F3 Deletion in a Boy with Intellectual Disability and Dysmorphic Features.
23006423 2012 Genetic association with overall survival of taxane-treated lung cancer patients - a genome-wide association study in human lymphoblastoid cell lines followed by a clinical association study.
22892427 2013 POU-III transcription factors (Brn1, Brn2, and Oct6) influence neurogenesis, molecular identity, and migratory destination of upper-layer cells of the cerebral cortex.
16582099 2006 The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15713637 2005 The class III POU domain protein Brn-1 can fully replace the related Oct-6 during schwann cell development and myelination.
9632656 1998 Cooperative function of POU proteins and SOX proteins in glial cells.
9457692 1998 Human class III POU genes, POU3F1 and POU3F3, map to chromosomes 1p34.1 and 3p14.2.
9105675 1997 The class III POU factor Brn-4 interacts with other class III POU factors and the heterogeneous nuclear ribonucleoprotein U.
8703082 1996 Class III POU genes: generation of homopolymeric amino acid repeats under GC pressure in mammals.
2739723 1989 Expression of a large family of POU-domain regulatory genes in mammalian brain development.