Property Summary

NCBI Gene PubMed Count 38
PubMed Score 111.33
PubTator Score 151.94

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytoma 1.100 4.5e-13
glioblastoma multiforme 1.200 4.9e-13
oligodendroglioma 1.100 5.6e-09
primitive neuroectodermal tumor 1.200 1.6e-02
pediatric high grade glioma 1.100 6.5e-04
group 4 medulloblastoma -3.400 1.6e-09
psoriasis -1.100 3.0e-05

Gene RIF (15)

PMID Text
26833329 We show that POU3F2 lies downstreamof SIM1 and controls oxytocin expression in the hypothalamic neuroendocrine preoptic area. We show that this finding is consistent with the expression patterns of POU3F2 and related genes in the human brain.
23530560 BRN2 is a higher level regulator than ASCL1 and ND1 and BRN2 might be involved in aggressiveness of small cell lung cancer.
23358112 TTF1 expression in small-cell lung cancer is a cell lineage-specific phenomenon that involves the developing neural cell-specific homeoprotein BRN2.
23069940 The present study investigated transcriptional regulation of CDH13 in melanoma. Found an inverse correlation between BRN2 and T-cadherin protein and transcript expression in melanoma.
22988297 PI3K has a crucial role in regulating Brn-2 and Pax3 expression and neoplasm invasiveness, and it is a key determinant of melanoma subpopulation diversity.
21435193 a model for the apparent non-overlapping expression levels of BRN2 and MITF in melanoma, mediated by miR-211 expression.
21358674 links BRN2 as an activator and MITF as a repressor of the NOTCH pathway in melanoma cells. Loss of the BRN2-MITF axis in antisense-ablated cell lines decreased the melanoma sphere-forming capability and cell adhesion
20337985 POU3F2 may regulate the properties of melanoma cells via autocrine KIT ligand signalling.
19023125 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18996486 Expression and purification of full-length BRN2, a transcription factor involved in melanoma growth, are reported.
18923447 SOX9 and SOX10 but not BRN2 seem to be required for nestin expression in human melanoma.
18829533 Brn-2 regulates invasiveness and directly represses Mitf expression.
17163992 Rb induces a proliferative arrest and regulates Brn-2 expression in retinoblastoma cells
16858508 Observational study of genotype prevalence. (HuGE Navigator)
15024080 The results suggest that the high levels of Brn-2 expression observed in melanomas link BRAF signaling to increased proliferation.

AA Sequence

MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWITALSHGGG      1 - 70
GGGGGGGGGGGGGGGGGGDGSPWSTSPLGQPDIKPSVVVQQGGRGDELHGPGALQQQHQQQQQQQQQQQQ     71 - 140
QQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLPPSMGASNGGLLYSQPSFTVNGMLGAGGQPAGL    141 - 210
HHHGLRDAHDEPHHADHHPHPHSHPHQQPPPPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQR    211 - 280
RIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAA    281 - 350
QGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLP    351 - 420
GAEDVYGGSRDTPPHHGVQTPVQ                                                   421 - 443
//

Text Mined References (41)

PMID Year Title
26833329 2016 Small 6q16.1 Deletions Encompassing POU3F2 Cause Susceptibility to Obesity and Variable Developmental Delay with Intellectual Disability.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24618891 2014 Genome-wide association study reveals two new risk loci for bipolar disorder.
23530560 2013 POU domain transcription factor BRN2 is crucial for expression of ASCL1, ND1 and neuroendocrine marker molecules and cell growth in small cell lung cancer.
23459443 2014 Drug-gene interactions and the search for missing heritability: a cross-sectional pharmacogenomics study of the QT interval.
23358112 2013 Neural lineage-specific homeoprotein BRN2 is directly involved in TTF1 expression in small-cell lung cancer.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23069940 2012 BRN2 is a transcriptional repressor of CDH13 (T-cadherin) in melanoma cells.
22988297 2012 A phosphatidylinositol 3-kinase-Pax3 axis regulates Brn-2 expression in melanoma.
21435193 2011 Melanoma cell invasiveness is regulated by miR-211 suppression of the BRN2 transcription factor.
21358674 2011 Inverse expression states of the BRN2 and MITF transcription factors in melanoma spheres and tumour xenografts regulate the NOTCH pathway.
20337985 2010 Genome-wide analysis of POU3F2/BRN2 promoter occupancy in human melanoma cells reveals Kitl as a novel regulated target gene.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19023125 2009 A genome-wide association study of schizophrenia using brain activation as a quantitative phenotype.
18996486 2009 Expression and purification of human full-length N Oct-3, a transcription factor involved in melanoma growth.
18923447 2009 SOX9 and SOX10 but not BRN2 are required for nestin expression in human melanoma cells.
18829533 2008 Brn-2 represses microphthalmia-associated transcription factor expression and marks a distinct subpopulation of microphthalmia-associated transcription factor-negative melanoma cells.
17163992 2006 Rb induces a proliferative arrest and curtails Brn-2 expression in retinoblastoma cells.
16858508 2006 Exclusion of mutations in the PRNP, JPH3, TBP, ATN1, CREBBP, POU3F2 and FTL genes as a cause of disease in Portuguese patients with a Huntington-like phenotype.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15024080 2004 The Brn-2 transcription factor links activated BRAF to melanoma proliferation.
15024079 2004 Brn-2 expression controls melanoma proliferation and is directly regulated by beta-catenin.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12782656 2003 The POU proteins Brn-2 and Oct-6 share important functions in Schwann cell development.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11029584 2000 Domains of Brn-2 that mediate homodimerization and interaction with general and melanocytic transcription factors.
10332029 1999 PQBP-1, a novel polyglutamine tract-binding protein, inhibits transcription activation by Brn-2 and affects cell survival.
9632656 1998 Cooperative function of POU proteins and SOX proteins in glial cells.
9482665 1998 Structure and regulation of the human growth hormone-releasing hormone receptor gene.
9178889 1997 N-Oct 5 is generated by in vitro proteolysis of the neural POU-domain protein N-Oct 3.
8441633 1993 cDNA cloning of human N-Oct3, a nervous-system specific POU domain transcription factor binding to the octamer DNA motif.
7651733 1995 The brn-2 gene regulates the melanocytic phenotype and tumorigenic potential of human melanoma cells.
7601453 1995 Isolation of the human genomic brain-2/N-Oct 3 gene (POUF3) and assignment to chromosome 6q16.
7478537 1995 The POU domain transcription factor Brn-2: elevated expression in malignant melanoma and regulation of melanocyte-specific gene expression.
2739723 1989 Expression of a large family of POU-domain regulatory genes in mammalian brain development.
2216722 1990 Astrocytes and glioblastoma cells express novel octamer-DNA binding proteins distinct from the ubiquitous Oct-1 and B cell type Oct-2 proteins.
1565620 1992 Structure and evolution of four POU domain genes expressed in mouse brain.