| Tbio | POU domain, class 3, transcription factor 1 |
Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Thought to be involved in early embryogenesis and neurogenesis.
Comments
| Disease | Target Count | P-value |
|---|---|---|
| posterior fossa group A ependymoma | 1511 | 1.2e-08 |
| ovarian cancer | 8491 | 2.9e-08 |
| psoriasis | 6685 | 1.3e-04 |
| group 4 medulloblastoma | 1875 | 1.6e-04 |
| medulloblastoma, large-cell | 6234 | 1.6e-03 |
| cutaneous lupus erythematosus | 1056 | 8.0e-03 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Rheumatoid Arthritis | 1170 | 0.0 | 5.0 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Neurogenic bowel | 6 | 3.781 | 1.9 |
| Bipolar Disorder | 266 | 3.595 | 1.8 |
| Schizophreniform disorder | 5 | 3.266 | 1.6 |
| Gender identity disorder | 3 | 3.02 | 1.5 |
| Disease | log2 FC | p |
|---|---|---|
| cutaneous lupus erythematosus | -1.400 | 8.0e-03 |
| psoriasis | -2.600 | 1.3e-04 |
| group 4 medulloblastoma | -1.200 | 1.6e-04 |
| medulloblastoma, large-cell | 1.200 | 1.6e-03 |
| posterior fossa group A ependymoma | -1.100 | 1.2e-08 |
| ovarian cancer | 1.300 | 2.9e-08 |
| PMID | Text | |
|---|---|---|
| 24671357 | Combined high OATP1A2/high OCT6 may be a potential predictor of response to anthracycline/taxane-based chemotherapy in breast cancer | |
| 21448695 | CpG island hypermethylation contributes to down-regulation of Oct-6 mRNA expression in hepatocellular carcinoma. | |
| 17959798 | Strict control of Pou3f1 transgene expression is critical to proper myelination, and factors responsible for Pouf31 downregulation during myelination may play important roles in the development of peripheral neuropathies. | |
| 17195013 | Our results suggest that Tst-1 and Skn-1a regulate expression of MMPs in keratinocytes and effect both the expression and activation of these proteolytic enzymes. |
MATTAQYLPRGPGGGAGGTGPLMHPDAAAAAAAAAAAERLHAGAAYREVQKLMHHEWLGAGAGHPVGLAH 1 - 70 PQWLPTGGGGGGDWAGGPHLEHGKAGGGGTGRADDGGGGGGFHARLVHQGAAHAGAAWAQGSTAHHLGPA 71 - 140 MSPSPGASGGHQPQPLGLYAQAAYPGGGGGGLAGMLAAGGGGAGPGLHHALHEDGHEAQLEPSPPPHLGA 141 - 210 HGHAHGHAHAGGLHAAAAHLHPGAGGGGSSVGEHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLAL 211 - 280 GTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGV 281 - 350 KGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDDVYAPGELGPG 351 - 420 GGGASPPSAPPPPPPAALHHHHHHTLPGSVQ 421 - 451 //
| PMID | Year | Title | |
|---|---|---|---|
| 24671357 | 2014 | Expression of organic anion-transporting polypeptide 1A2 and organic cation transporter 6 as a predictor of pathologic response to neoadjuvant chemotherapy in triple negative breast cancer. | |
| 23192594 | 2013 | Gene-environment interactions and obesity traits among postmenopausal African-American and Hispanic women in the Women's Health Initiative SHARe Study. | |
| 22589738 | 2012 | Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women. | |
| 21448695 | 2011 | Aberrant CpG island hypermethylation and down-regulation of Oct-6 mRNA expression in human hepatocellular carcinoma. | |
| 20453842 | 2010 | Genome-wide association study meta-analysis identifies seven new rheumatoid arthritis risk loci. | |
| 17959798 | 2007 | Misexpression of Pou3f1 results in peripheral nerve hypomyelination and axonal loss. | |
| 17195013 | 2007 | Matrix metalloproteinase-19 expression in keratinocytes is repressed by transcription factors Tst-1 and Skn-1a: implications for keratinocyte differentiation. | |
| 16710414 | 2006 | The DNA sequence and biological annotation of human chromosome 1. | |
| 12557005 | 2003 | Oct6, a transcription factor controlling myelination, is a marker for active nerve regeneration in peripheral neuropathies. | |
| 9742157 | 1998 | Promyelinating Schwann cells express Tst-1/SCIP/Oct-6. | |
| 9457692 | 1998 | Human class III POU genes, POU3F1 and POU3F3, map to chromosomes 1p34.1 and 3p14.2. | |
| 9242494 | 1997 | Functions of the POU domain genes Skn-1a/i and Tst-1/Oct-6/SCIP in epidermal differentiation. | |
| 9105675 | 1997 | The class III POU factor Brn-4 interacts with other class III POU factors and the heterogeneous nuclear ribonucleoprotein U. | |
| 8663425 | 1996 | Identification of the nuclear localization signal of the POU domain protein Tst-1/Oct6. | |
| 8662541 | 1996 | The POU factor Oct-6 and Schwann cell differentiation. | |
| 8567814 | 1995 | Expression of transcription regulating genes in human preimplantation embryos. | |
| 8451175 | 1993 | The human Oct-6 POU transcription factor lacks the first 50 amino acids of its murine counterpart. | |
| 7909356 | 1994 | Oct-6: a regulator of keratinocyte gene expression in stratified squamous epithelia. | |
| 7791781 | 1995 | Functional interaction between the POU domain protein Tst-1/Oct-6 and the high-mobility-group protein HMG-I/Y. | |
| 7720710 | 1995 | High mobility group protein 2 functionally interacts with the POU domains of octamer transcription factors. | |
| 1976514 | 1990 | Oct-6: a POU transcription factor expressed in embryonal stem cells and in the developing brain. | |
| 1975954 | 1990 | Expression and activity of the POU transcription factor SCIP. |
