Property Summary

NCBI Gene PubMed Count 47
PubMed Score 28.66
PubTator Score 389.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Peripheral Neuropathy 303
Disease Target Count Z-score Confidence
Lymphoma 57 3.133 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -3.200 2.5e-08
cystic fibrosis 1.179 2.1e-03
primitive neuroectodermal tumor 1.700 3.0e-02
interstitial cystitis 1.900 4.6e-03
primary Sjogren syndrome 1.300 5.7e-03
ulcerative colitis 1.100 9.5e-03

Gene RIF (21)

PMID Text
24435047 Mutations in linker histone genes HIST1H1 B, C, D, and E; OCT2 (POU2F2); IRF8; and ARID1A underlying the pathogenesis of follicular lymphoma.
24367622 a differential control exerted by both Oct-1 and Oct-2 in the transcriptional regulation of the HMGA1 gene
22346751 B-cell specific transcription factor, Oct-2, inhibits the function of the viral immediate-early protein, BZLF1, and prevents lytic viral reactivation. Oct-2 potentiates establishment of EBV latency in B cells.
22158496 Half of the cases displayed Oct-2 expression (15/30 cases) of systemic anaplastic large-cell lymphoma measured by tissue microarray immunohistochemistry.
21424034 Twenty-two cases of nodular lymphocyte predominant Hodgkin lymphoma were studied for the immunohistochemical expression of Pax-5, Oct-2, BOB.1, Bcl-6 protein and MUM1/IRF-4.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20363215 Gefitinib may exert an inhibitory effect on the intracellular accumulation of drugs transported by hOCT1 and hOCT2.
20141429 OCT-2 may act as a cell survival factor in acute myeloid leukemia by mediating expression of downstream targets, such as BCL-2.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19625999 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19536068 Renal OCT2 expression is no important in the renal excretion of metformin
19271143 Data suggest that OCT2 and/or OCT3 might be involved in the initial component of histamine uptake, whereas the later component of histamine uptake is likely to be mediated by another, as yet undefined uptake system(s).
19270158 Oct-2, was studied in detail and found to be a bifunctional regulator: It can either repress or induce neuronal differentiation, depending on the particular isoform
18695675 Oct-2 and its cofactor Bob-1 have an important function in mediating the IgH enhancer-bcl-2 promoter region interactions
17442950 The transcription factors Oct-1 and -2 inhibit and enhance, respectively, the expression of exon 1-containing transcripts and CCR5 surface levels.
16186795 Oct-2, therefore, acts as a cell survival factor in t(14;18) lymphoma cells by directly activating the antiapoptotic gene bcl-2.
16061936 Transcription factors Oct-1, Oct-2, PU.1, Sp1, and Sp3 are recruited to the HS7 regulatory site in the pol coding region, suggesting that Oct-1, Oct-2, PU.1, Sp1, and Sp3 indirectly interact with HIV-1 Pol
15831936 physical binding to the family of repeats in Epstein-Barr virus oriP by the cellular transcription factors Oct-1 and Oct-2 was demonstrated by using an electrophoretic mobility-shift assay
15796964 Alteration of the OCT2 locus does not correlate with its suppressed expression in Hodgkin lymphoma.
14707079 DNase I-hypersensitive site 4 (hs4) enhancer activity in mature Burkitt's lymphoma B cells is regulated by synergistic involvement of both Oct-2 and NF-kappa B family members; Oct-2 is required for hs4 enhancer activity.
14662861 The function of human Oct-2 in immunoglobulin(Ig)-secreting cells requires plasmacytoma-specific coativator OCA-B working synergistically to sustain the gene expression profile of the Ig-secreting cell.

AA Sequence

MVHSSMGAPEIRMSKPLEAEKQGLDSPSEHTDTERNGPDTNHQNPQNKTSPFSVSPTGPSTKIKAEDPSG      1 - 70
DSAPAAPLPPQPAQPHLPQAQLMLTGSQLAGDIQQLLQLQQLVLVPGHHLQPPAQFLLPQAQQSQPGLLP     71 - 140
TPNLFQLPQQTQGALLTSQPRAGLPTQAVTRPTLPDPHLSHPQPPKCLEPPSHPEEPSDLEELEQFARTF    141 - 210
KQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAETMSVDSSLPSP    211 - 280
NQLSSPSLGFDGLPGRRRKKRTSIETNVRFALEKSFLANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQ    281 - 350
KEKRINPCSAAPMLPSPGKPASYSPHMVTPQGGAGTLPLSQASSSLSTTVTTLSSAVGTLHPSRTAGGGG    351 - 420
GGGGAAPPLNSIPSVTPPPPATTNSTNPSPQGSHSAIGLSGLNPSTGPGLWWNPAPYQP               421 - 479
//

Text Mined References (49)

PMID Year Title
24435047 2014 Mutations in linker histone genes HIST1H1 B, C, D, and E; OCT2 (POU2F2); IRF8; and ARID1A underlying the pathogenesis of follicular lymphoma.
24367622 2013 Transcriptional regulation of the HMGA1 gene by octamer-binding proteins Oct-1 and Oct-2.
22346751 2012 The B-cell specific transcription factor, Oct-2, promotes Epstein-Barr virus latency by inhibiting the viral immediate-early protein, BZLF1.
22158496 Immunohistochemical expression of Mum-1, Oct-2 and Bcl-6 in systemic anaplastic large cell lymphomas.
21424034 2011 B-cell transcription factors Pax-5, Oct-2, BOB.1, Bcl-6, and MUM1 are useful markers for the diagnosis of nodular lymphocyte predominant Hodgkin lymphoma.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20363215 2010 Functional characterization of gefitinib uptake in non-small cell lung cancer cell lines.
20141429 2010 OCT-2 expression and OCT-2/BOB.1 co-expression predict prognosis in patients with newly diagnosed acute myeloid leukemia.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19625999 2009 Contribution of organic cation transporter 2 (OCT2) to cisplatin-induced nephrotoxicity.
19536068 2009 The effects of genetic polymorphisms in the organic cation transporters OCT1, OCT2, and OCT3 on the renal clearance of metformin.
19271143 2009 Involvement of the organic cation transporters in histamine uptake into human vascular endothelial cells.
19270158 2009 A high throughput embryonic stem cell screen identifies Oct-2 as a bifunctional regulator of neuronal differentiation.
18695675 2008 Functional long-range interactions of the IgH 3' enhancers with the bcl-2 promoter region in t(14;18) lymphoma cells.
17442950 2007 Production of specific mRNA transcripts, usage of an alternate promoter, and octamer-binding transcription factors influence the surface expression levels of the HIV coreceptor CCR5 on primary T cells.
16186795 2006 Oct transcription factors mediate t(14;18) lymphoma cell survival by directly regulating bcl-2 expression.
15831936 2005 Functional interaction of Oct transcription factors with the family of repeats in Epstein-Barr virus oriP.
15796964 2005 Alterations of loci encoding PU.1, BOB1, and OCT2 transcription regulators do not correlate with their suppressed expression in Hodgkin lymphoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14707079 2004 NF-kappa B and Oct-2 synergize to activate the human 3' Igh hs4 enhancer in B cells.
14662861 2003 Critical role for the Oct-2/OCA-B partnership in Ig-secreting cells.
12663137 2003 Human Oct-1L isoform has tissue-specific expression pattern similar to Oct-2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12144930 2002 3-Hydroxy-3-methylglutaryl coenzyme A reductase inhibitors increase the binding activity and nuclear level of Oct-1 in mononuclear cells.
11841448 2002 Expression of transcription factors Pu.1, Spi-B, Blimp-1, BSAP and oct-2 in normal human plasma cells and in multiple myeloma cells.
11583619 2001 Differential dimer activities of the transcription factor Oct-1 by DNA-induced interface swapping.
11279128 2001 The binding of Ku antigen to homeodomain proteins promotes their phosphorylation by DNA-dependent protein kinase.
10490647 1999 Developmental effects of ectopic expression of the glucocorticoid receptor DNA binding domain are alleviated by an amino acid substitution that interferes with homeodomain binding.
10480874 1999 Selective binding of steroid hormone receptors to octamer transcription factors determines transcriptional synergism at the mouse mammary tumor virus promoter.
9870616 1998 The different alternatively spliced isoforms of the Oct-2 transcription factor repress the involucrin promoter in a cell type-specific manner.
9819426 1998 Coactivator OBF-1 makes selective contacts with both the POU-specific domain and the POU homeodomain and acts as a molecular clamp on DNA.
9584182 1998 Recruitment of octamer transcription factors to DNA by glucocorticoid receptor.
9442393 1997 Identification of target genes of the lymphoid-specific transcription factor Oct2.
9368058 1997 The cyclin-dependent kinase-activating kinase (CAK) assembly factor, MAT1, targets and enhances CAK activity on the POU domains of octamer transcription factors.
9242494 1997 Functions of the POU domain genes Skn-1a/i and Tst-1/Oct-6/SCIP in epidermal differentiation.
9078256 1997 The octamer-binding proteins Oct-1 and Oct-2 repress the HIV long terminal repeat promoter and its transactivation by Tat.
8902060 1996 Functional interaction between the HIV-1 Tat transactivator and the inhibitory domain of the Oct-2 cellular transcription factor.
8202368 1994 The POU domains of the Oct1 and Oct2 transcription factors mediate specific interaction with TBP.
8156594 1994 Crystal structure of the Oct-1 POU domain bound to an octamer site: DNA recognition with tethered DNA-binding modules.
7914745 1994 Solution structure of a POU-specific homeodomain: 3D-NMR studies of human B-cell transcription factor Oct-2.
7888080 1994 Short introns interrupting the Oct-2 POU domain may prevent recombination between POU family genes without interfering with potential POU domain 'shuffling' in evolution.
7720710 1995 High mobility group protein 2 functionally interacts with the POU domains of octamer transcription factors.
3265124 1988 The B-cell-specific Oct-2 protein contains POU box- and homeo box-type domains.
3072196 1988 Identification of a novel lymphoid specific octamer binding protein (OTF-2B) by proteolytic clipping bandshift assay (PCBA).
2904654 1988 A human lymphoid-specific transcription factor that activates immunoglobulin genes is a homoeobox protein.
2904653 1988 A cloned octamer transcription factor stimulates transcription from lymphoid-specific promoters in non-B cells.
2901913 1988 A human protein specific for the immunoglobulin octamer DNA motif contains a functional homeobox domain.
2328728 1990 Transcription factor Oct-2A contains functionally redundant activating domains and works selectively from a promoter but not from a remote enhancer position in non-lymphoid (HeLa) cells.
1739980 1992 Promoter-selective activation domains in Oct-1 and Oct-2 direct differential activation of an snRNA and mRNA promoter.