Property Summary

NCBI Gene PubMed Count 148
PubMed Score 135.43
PubTator Score 335.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Meningoencephalitis 13 4.4 2.2

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 2.200 4.4e-08
astrocytic glioma 1.200 3.0e-03
osteosarcoma -2.056 1.3e-06
group 3 medulloblastoma 1.900 1.5e-04
primitive neuroectodermal tumor 1.100 1.0e-02

Gene RIF (106)

PMID Text
27126747 OCT-1 plays a critical role in CD4 T cells through regulating gene expression during differentiation and mediating long-range chromosomal interactions. (Review)
27063953 Oct-1 is a direct link of transcription factors with the core transcriptional machinery and chromatin remodeling and, depending on other factors present in particular cell types, it can direct cell type specific regulation. (Review)
26464716 single-nucleotide polymorphisms of OCT1 have selective effects on the glycemic response to metformin
26178483 OCT1 siRNA significantly reduced the proliferation rate of SW620 and LoVo cells, inhibited the migration and invasion, and could reverse EMT in these two CRC cells, indicating that OCT1 plays a critical role in Colorectal cancer progression
25937278 levels of microRNA-451 (miR-451) are negatively regulated through the phosphorylation and inactivation of its direct transcriptional activator OCT1 by 5' AMP-activated protein kinase
25631079 These experiments suggested that some human herpesvirus 8-infected PEL cell line-specific DNA-binding factors, such as OCT-1, should be involved in the upregulation of ANGPT-1 in a sequence-dependent manner.
25510240 These results suggest that reduced OCT1 transport is an important determinant of metformin intolerance.
25301728 POU2F1 activity regulates HOXD10 and HOXD11 gene expression in head and neck squamous cell carcinoma, promoting a proliferative and invasive phenotype.
25236570 we demonstrate that the Oct-1 transcription factor, commonly considered pro-proliferative, indeed facilitates IFN-gamma induced apoptosis in 5637 bladder carcinoma cells
24753226 combination of prelamin A accumulation and stress conditions enhance the aging phenotype by dysregulating the activity of the octamer binding protein Oct-1
24589908 hOCT1 c.480C>G SNP may significantly influence imatinib pharmacokinetics, supporting further analyses in larger groups of patients
24566898 OCT-1 overexpression may be a marker for poor prognosis in patients with well-differentiated gastric adenocarcinoma.
24477584 Our study provided evidence to IDE, PON1, WFS1, POU2F1, IL1alpha and IL1beta associated with T2D in Pakistanis.
24466753 The new isoform of Oct-1 transcription factor is transcribed from alternative promoter.
24367622 a differential control exerted by both Oct-1 and Oct-2 in the transcriptional regulation of the HMGA1 gene
24121026 T3 throid hormone enhanced the recruitment of the TRbeta1/Oct-1 complex on Octamer-transcription factor-1 site within cyclin D1 promoter.
23657650 a new alternative promoter in the gene of the oct-1 transcription factor
23580612 Data suggest that Oct1/Pou2f1 integrates metabolic and stress signals via O-GlcNAc modification to regulate target gene activity.
23261988 Results indicate that lamin B1 (LMNB1) accumulation in adult-onset autosomal dominant leukodystrophy (ADLD) is associated with Oct-1 recruitment.
23172665 STAT3 regulates the transcription and expression of Oct-1 by directly targeting its promoter.
23053895 This study shows that long-term exposure to cisplatin promotes methylation of the OCT1 gene in human esophageal cancer cells, which in turn results in cisplatin resistance.
22883199 The expression levels of hOCT1 and ABCB1 vary in different disease states of chronic myelocytic leukemia patients on imatinib mesylate therapy. These two genes may influence the time from first complete cytogenetic remission.
22842522 Our findings establish the impact of Oct1, KLF4 and c-Myc on cancer bioenergetics and evidence a link between oncosecretomics and cellular bioenergetics profile.
22777240 our results did not show any pathogenic HOXA1 mutation, our results suggest that VSD might not be a clinically isolated manifestation of HOXA1 mutations.
22750226 Oct-1 acts as a transcriptional repressor of C-reactive protein expression and it does so by occupying its cognate site on the promoter and also via other transcription factors by an as yet undefined mechanism
22521726 AK inhibitor MK-0457 induces the growth arrest DNA damage-inducible (Gadd) 45a through recruitment of octamer-binding (Oct)-1 transcription factor at a critical promoter region for gene transcription and covalent modifications of histone H3.
22396547 Sox2 modulates the mechanism of translocation of Oct1. Both Sox2 and the Oct1 POU(HD) domain are transiently released from the specific ternary complex by sliding to an adjacent nonspecific site, followed by direct transfer to another DNA molecule
22349263 propose that, through interaction with the initiation complex, Oct-1 regulates iNOS transcription by priming the gene for the rapid response required in an immune response
22310390 Exogenous Oct-1 expression showed a concentration-dependent activation of U6 promoter that was further stimulated by the p38 kinase inhibitors.
21985966 Oct-1 is downregulated by reactive oxygen species via CpG island methylation in its promoter
21897860 role for Oct1 in mitosis
21697476 The authors demonstrate that the cellular transcription factor Oct-1 cooperates with the EBV immediate-early protein BRLF1 (R, Rta) to induce lytic viral reactivation.
21562485 polymorphisms in OCT1 influence the pharmacokinetics of O-desmethyltramadol, presumably by affecting its uptake into liver cells
21555551 analysis of Oct1 characterized by liquid crystal and paramagnetic NMR
21444690 The findings invoke a model wherein incomplete DNA synthesis during S phase leads to a DNA damage response and formation of 53BP1-OPT domains in the subsequent G1.
21399967 antioxidative response element-like/Oct-1 binding site was noticed to be essential for shear stress-dependent downregulation of Nox4
21387309 patients with high immunoreactivity of Oct1 showed a low cancer-specific survival rate.
21320718 the single nucleotide polymorphism rs1046295 of PHF11 modulates allele-specific binding by the octamer-binding transcription factor 1
21185600 Genetic polymorphisms of the OCT1 is associated with the response to imatinib in patients newly diagnosed with chronic-phase chronic myeloid leukemia
21059098 Using separate cohorts, we observed consistent results showing the contribution of multiple variants at POU2F1 to the risk of Type 2 diabetes.
21059098 Observational study of gene-disease association. (HuGE Navigator)
20971815 High OCT-1 is associated with chronic myeloid leukemia.
20956498 Increased OCT1 gene expression in adipose tissue of obese subjects may contribute to increased metformin action in these subjects.
20921968 Overexpression of wild-type, but not OCT1 loss-of-function variants, significantly increased tropisetron uptake. Correspondingly, patients with two loss-of-function OCT1 alleles had higher tropisetron plasma concentrations.
20886065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20713004 The molecular features of the DNA search mechanism were explored for two multidomain transcription factors: human Pax6 and Oct-1.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19965638 HMGB2 potentiates GATA-1-dependent transcription of GFI1B by Oct-1 and thereby controls erythroid differentiation.
19898263 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19804407 The interplay between Oct-1 and unknown transcription factors may be responsible for the IL-4 C-33T polymorphism effects.
19617623 Data show that elevation of cAMP leads to enhanced phosphorylation and nuclear exclusion of Oct-1 and reduced interactions between Oct-1 or nuclear co-repressors and the Cdx-2 gene promoter.
19536175 Observational study of gene-disease association. (HuGE Navigator)
19467240 functional Oct-1 enhancer motif at -10.2 kb in the hiNOS promoter regulates cytokine-induced hiNOS gene transcription and further underscores tight control mechanisms regulating the expression of the hiNOS gene.
19463811 Results discuss how constitutively bound factors such as NF1 and Oct1 may participate in the maintenance of tissue specificity of genes responsive to hormones through receptors such as the glucocorticoid receptor.
19422935 Observational study of gene-disease association. (HuGE Navigator)
19359385 Observations identify Oct-1 as a transcriptional repressor of ChREBP and suggest that insulin stimulates ChREBP expression via attenuating the repressive effect of Oct-1.
19327156 Disrupting the bindings of the Oct-1 transcriptional factors with the decoy oligonucleotide provides a novel approach for inducing expression of the gamma-globin genes.
19240061 Observational study of gene-disease association. (HuGE Navigator)
19174780 Observational study of gene-disease association. (HuGE Navigator)
19171782 we show that association of Oct4 and Oct1 with a distinct group of in vivo targets is inducible by stress, and that Oct1 is essential for a normal post-stress transcriptional response
19118657 Oct-1 is involved in the regulation of CDKN1A in reponse to clinically relevant doses of ionizing radiation.
19070619 O-linked N-acetylglucosamines within the second serine/threonine-rich region of Sp1 interrupts a known interaction between Sp1 and Oct1
19064610 Observational study of gene-disease association. (HuGE Navigator)
19058140 Oct1 may have regulatory functions in prostate development and cancer progression.
18772384 intersegmental transfer involves a ternary intermediate, or transition state in which the DNA-binding domains bridge two different DNA fragments simultaneously
18682386 A redox-modulated direct p38/GAPDH-Oct-1 interaction nucleates the occupancy of the H2B promoter by the OCA-S complex, in which p36/LDH plays a critical role in the hierarchical organization of the complex.
18634911 A functional role of PPARgamma/RXRalpha and Oct-1 in the regulation of the FABP2 gene.
18599544 Testosterone represses MAFbx expression via interactions of the AR with Oct-1.
18550719 Oct-1 transactivates hPTTG1, and both proteins are concordantly overexpressed in endocrine tumors.
18390905 LOX-1 receptor blockade abrogates oxLDL-induced oxidative DNA damage and prevents activation of the transcriptional repressor Oct-1 in human coronary arterial endothelium.
18083338 Suggest that Oct-1 may play an important role in the development of primary lower extremity varicose veins.
18030470 The cytotoxicity of oxaliplatin was suggested to be affected by the levels of ATP7A and hOCT1 mRNAs.
17442950 The transcription factors Oct-1 and -2 inhibit and enhance, respectively, the expression of exon 1-containing transcripts and CCR5 surface levels.
17316622 Oct-1 is an important transcriptional repressor for p15(INK4b) gene and the transcriptional repression of the p15(INK4b) gene by Oct-1 may be one of the regulatory mechanisms of cellular senescence.
17273778 POU5F1 and POU2F subfamily members play a pivotal role for the FZD5 expression in undifferentiated human ES cells, fetal liver/spleen, adult colon, pancreatic islet, and diffuse-type gastric cancer
17192276 interleukin-6 induces Oct-1 gene expression, providing a biologically relevant means by which NF-kappaB-dependent gene expression can be selectively reverted by Oct-1 to quiescent levels
16360016 in the case of one non-small cell lung carcinoma line (NSCLC), Rb re-expression failed to rescue HLA-DRA inducibility despite successful re-establishment of Rb-function; this failure is traceable to the failure of Rb to rescue normal Oct-1 function
16301215 the binding of Oct-1 to the T-13,910 lactase variant directs increased lactase promoter activity and this might provide an explanation for the lactase persistence phenotype in the human population
16186125 identified an AHSP gene erythroid promoter with functionally important binding sites for GATA-1- and Oct-1-related proteins
16116232 Regulation of basal and induced expression of C-reactive protein through an overlapping element for OCT-1 and NF-kappaB on the proximal promoter.
16061936 Transcription factors Oct-1, Oct-2, PU.1, Sp1, and Sp3 are recruited to the HS7 regulatory site in the pol coding region, suggesting that Oct-1, Oct-2, PU.1, Sp1, and Sp3 indirectly interact with HIV-1 Pol
16002402 Data show that GRG proteins, including GRG5, interact with two regulators of GnRH transcription, the homeodomain proteins MSX1 and OCT1, and regulate GnRH promoter activity.
15831936 physical binding to the family of repeats in Epstein-Barr virus oriP by the cellular transcription factors Oct-1 and Oct-2 was demonstrated by using an electrophoretic mobility-shift assay
15817654 OCT-1 binds within DHS3 to silence Fshr transcription, an activity that involves members of the GATA family
15786443 Observational study of gene-disease association. (HuGE Navigator)
15613485 a multiprotein complex containing GATA-1, Oct-1, and other protein factors may contribute to the formation of a repressive chromatin structure that silences gamma-globin gene expression
15207707 Transcription factors Oct-1, Oct-2, PU.1, Sp1, and Sp3 are recruited to the HS7 regulatory site in the pol coding region, suggesting that Oct-1, Oct-2, PU.1, Sp1, and Sp3 indirectly interact with HIV-1 Pol
15138251 Oct-1 and the TALE homeodomain proteins have roles in regulating the expression of the GnRH gene in neurons
15105429 Data show that Oct-1 occupies the endogenous HLA-DRA promoter when the HLA-DRA promoter is inactive in retinoblastoma protein-defective cells.
14645506 transcriptional regulation of the key cell cycle regulator cyclin D1 and roles of both STAT5 and Oct-1 in this process
14612514 Results suggest a mechanism for the regulation of Oct-1 in response to DNA damage through specific phosphorylation within the NH(2)-terminal transcriptional regulatory domain.
14586402 Histone deacetylase inhibitors can induce Gadd45 through its promoter without the need for functional p53, and both Oct-1 and NF-Y concertedly participate in trichostatin A-induced activation of the gadd45 promoter.
14559893 OCT1 and SOX2 have roles in transcriptional activation of the Oct1.Sox2.Hoxb1-DNA ternary transcription factor complex
12887926 OCA-S is a multicomponent OCT1 coactivator which has been isolated and functionally characterized.
12887915 The Oct-1 protein has been isolated,purified and characterized functionally. Histone gene expression is dependent on OCT1 and OCA-S coactivator complex.
12853155 transcription of the Oct-1 gene is regulated by two promoters located upstream of the exon 1U and upstream of the exon 1L
12727885 enhancement of transcriptional potential by OBF1
12672812 Selective inhibition of class switching to IGG and IgE by recruitment of this and HOXC4 proteins and Ku70/ku86 to newly identified ATTT cis-elements.
12669425 Our data on the interaction of two promoters with the enhancer and silencer in different cell types point to fine tissue-specific regulation of the oct-1 gene expression, especially in lymphatic cells.
12446597 results clearly indicate a role of octamer transcription factor-1 in the transcriptional repression of the human gonadotropin-releasing hormone receptor gene
12391146 Oct-1 potentiates CREB-dependent cyclin D1 transcriptional activity by a phospho-CREB and CREB binding protein-independent mechanism
12019209 Inflammatory bowel disease is associated with a TNF polymorphism that affects an interaction between the OCT1 and NF(-kappa)B transcription factors
11997177 Results demonstrate that functional interaction of Oct-1 and Brn-1 with androgen receptors is determined by the precise sequence of the octamer binding site, and by differential interaction with transcriptional machinery.
11777930 immunodepletion of Oct-1 and NF-YA proteins or mutations in the OCT-1 and CAAT motifs disrupt BRCA1 binding to the GADD45 promoter
7690421 Transcription factors Oct-1, Oct-2, PU.1, Sp1, and Sp3 are recruited to the HS7 regulatory site in the pol coding region, suggesting that Oct-1, Oct-2, PU.1, Sp1, and Sp3 indirectly interact with HIV-1 Pol

AA Sequence

MNNPSETSKPSMESGDGNTGTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNV      1 - 70
QSKSNEESGDSQQPSQPSQQPSVQAAIPQTQLMLAGGQITGLTLTPAQQQLLLQQAQAQAQLLAAAVQQH     71 - 140
SASQQHSAAGATISASAATPMTQIPLSQPIQIAQDLQQLQQLQQQNLNLQQFVLVHPTTNLQPAQFIISQ    141 - 210
TPQGQQGLLQAQNLLTQLPQQSQANLLQSQPSITLTSQPATPTRTIAATPIQTLPQSQSTPKRIDTPSLE    211 - 280
EPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWL    281 - 350
NDAENLSSDSSLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEK    351 - 420
EVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFPSPTSLVATTPSLVTSSAATTLTVSPVLPLTSAAVT    421 - 490
NLSVTGTSDTTSNNTATVISTAPPASSAVTSPSLSPSPSASASTSEASSASETSTTQTTSTPLSSPLGTS    491 - 560
QVMVTASGLQTAAAAALQGAAQLPANASLAAMAAAAGLNPSLMAPSQFAAGGALLSLNPGTLSGALSPAL    561 - 630
MSNSTLATIQALASGGSLPITSLDATGNLVFANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSAAAASA    631 - 700
GNSAPVASLHATSTSAESIQNSLFTVASASGAASTTTTASKAQ                               701 - 743
//

Text Mined References (159)

PMID Year Title
27126747 2016 Role of OCT-1 and partner proteins in T cell differentiation.
27063953 2016 Oct-1, to go or not to go? That is the PolII question.
26464716 2015 Genetic variants of OCT1 influence glycemic response to metformin in Han Chinese patients with type-2 diabetes mellitus in Shanghai.
26178483 2015 Octamer transcription factor 1 mediates epithelial-mesenchymal transition in colorectal cancer.
25937278 2015 Glucose-based regulation of miR-451/AMPK signaling depends on the OCT1 transcription factor.
25631079 2015 Mechanism of angiopoietin-1 upregulation in Kaposi's sarcoma-associated herpesvirus-infected PEL cell lines.
25510240 2015 Association of Organic Cation Transporter 1 With Intolerance to Metformin in Type 2 Diabetes: A GoDARTS Study.
25416956 2014 A proteome-scale map of the human interactome network.
25301728 2014 POU2F1 activity regulates HOXD10 and HOXD11 promoting a proliferative and invasive phenotype in head and neck cancer.
25236570 2014 An Oct-1-based, feed-forward mechanism of apoptosis inhibited by co-culture with Raji B-cells: towards a model of the cancer cell/B-cell microenvironment.
24753226 2014 Prelamin A accumulation and stress conditions induce impaired Oct-1 activity and autophagy in prematurely aged human mesenchymal stem cell.
24589908 2014 The c.480C>G polymorphism of hOCT1 influences imatinib clearance in patients affected by chronic myeloid leukemia.
24566898 2014 OCT-1 overexpression is associated with poor prognosis in patients with well-differentiated gastric cancer.
24477584 2014 Genetic association of IDE, POU2F1, PON1, IL1? and IL1? with type 2 diabetes in Pakistani population.
24466753 [The new isoform of Oct-1 transcription factor is transcribed from alternative promoter].
24367622 2013 Transcriptional regulation of the HMGA1 gene by octamer-binding proteins Oct-1 and Oct-2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24121026 2014 T3 enhances thyroid cancer cell proliferation through TR?1/Oct-1-mediated cyclin D1 activation.
23657650 New alternative promoter in regulation of the Oct-1 human gene transcription.
23580612 2013 Regulation of Oct1/Pou2f1 transcription activity by O-GlcNAcylation.
23261988 2013 Oct-1 recruitment to the nuclear envelope in adult-onset autosomal dominant leukodystrophy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23172665 2013 STAT3 is involved in esophageal carcinogenesis through regulation of Oct-1.
23053895 2013 Long-term cisplatin exposure promotes methylation of the OCT1 gene in human esophageal cancer cells.
22883199 2012 [Effects of hOCT1 and ABCB1 gene on the efficacy of imatinib mesylate in chronic myelocytic leukemia].
22842522 2012 Oncosecretomics coupled to bioenergetics identifies ?-amino adipic acid, isoleucine and GABA as potential biomarkers of cancer: Differential expression of c-Myc, Oct1 and KLF4 coordinates metabolic changes.
22777240 2013 HOXA1 gene is not potentially related to ventricular septal defect in Chinese children.
22750226 2012 Oct-1 acts as a transcriptional repressor on the C-reactive protein promoter.
22521726 2012 Gadd45a transcriptional induction elicited by the Aurora kinase inhibitor MK-0457 in Bcr-Abl-expressing cells is driven by Oct-1 transcription factor.
22396547 2012 Interplay between minor and major groove-binding transcription factors Sox2 and Oct1 in translocation on DNA studied by paramagnetic and diamagnetic NMR.
22349263 2012 Oct-1 cooperates with the TATA binding initiation complex to control rapid transcription of human iNOS.
22310390 2012 Negative regulation of human U6 snRNA promoter by p38 kinase through Oct-1.
21985966 2011 Reactive oxygen species downregulate catalase expression via methylation of a CpG island in the Oct-1 promoter.
21897860 2011 Dynamic regulation of Oct1 during mitosis by phosphorylation and ubiquitination.
21697476 2011 Cellular transcription factor Oct-1 interacts with the Epstein-Barr virus BRLF1 protein to promote disruption of viral latency.
21562485 2011 Genetically polymorphic OCT1: another piece in the puzzle of the variable pharmacokinetics and pharmacodynamics of the opioidergic drug tramadol.
21555551 2011 Intra- and intermolecular translocation of the bi-domain transcription factor Oct1 characterized by liquid crystal and paramagnetic NMR.
21444690 2011 Replication stress induces 53BP1-containing OPT domains in G1 cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21399967 2011 Arterial flow reduces oxidative stress via an antioxidant response element and Oct-1 binding site within the NADPH oxidase 4 promoter in endothelial cells.
21387309 2012 Oct1 regulates cell growth of LNCaP cells and is a prognostic factor for prostate cancer.
21320718 2011 Allele-specific transcription of the asthma-associated PHD finger protein 11 gene (PHF11) modulated by octamer-binding transcription factor 1 (Oct-1).
21269460 2011 Initial characterization of the human central proteome.
21185600 2011 Correlation between genetic polymorphisms of the hOCT1 and MDR1 genes and the response to imatinib in patients newly diagnosed with chronic-phase chronic myeloid leukemia.
21059098 2010 Association of the POU class 2 homeobox 1 gene (POU2F1) with susceptibility to Type 2 diabetes in Chinese populations.
20971815 2011 OCT-1 function varies with cell lineage but is not influenced by BCR-ABL.
20956498 2011 OCT1 Expression in adipocytes could contribute to increased metformin action in obese subjects.
20921968 2012 Effects of OCT1 polymorphisms on the cellular uptake, plasma concentrations and efficacy of the 5-HT(3) antagonists tropisetron and ondansetron.
20886065 2010 Molecular reclassification of Crohn's disease by cluster analysis of genetic variants.
20713004 2010 Facilitated DNA search by multidomain transcription factors: cross talk via a flexible linker.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19965638 2010 High-mobility group protein HMGB2 regulates human erythroid differentiation through trans-activation of GFI1B transcription.
19898263 2010 Interaction between polymorphisms in the OCT1 and MATE1 transporter and metformin response.
19804407 2010 Oct-1 is responsible for the C-33T polymorphism effect in the IL-4 promoter.
19617623 2009 POU homeodomain protein Oct-1 functions as a sensor for cyclic AMP.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19467240 2009 A far-upstream Oct-1 motif regulates cytokine-induced transcription of the human inducible nitric oxide synthase gene.
19463811 2009 Histone acetylation characterizes chromatin presetting by NF1 and Oct1 and enhances glucocorticoid receptor binding to the MMTV promoter.
19422935 2009 Genetic risk profiling and prediction of disease course in Crohn's disease patients.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19359385 2009 Insulin stimulates the expression of carbohydrate response element binding protein (ChREBP) by attenuating the repressive effect of Pit-1, Oct-1/Oct-2, and Unc-86 homeodomain protein octamer transcription factor-1.
19327156 2009 Induction of endogenous gamma-globin gene expression with decoy oligonucleotide targeting Oct-1 transcription factor consensus sequence.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19174780 2009 Confirmation of multiple Crohn's disease susceptibility loci in a large Dutch-Belgian cohort.
19171782 2009 A general mechanism for transcription regulation by Oct1 and Oct4 in response to genotoxic and oxidative stress.
19118657 2009 Involvement of Oct-1 in the regulation of CDKN1A in response to clinically relevant doses of ionizing radiation.
19070619 2009 O-GlcNAc modification of Sp1 inhibits the functional interaction between Sp1 and Oct1.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
19058140 2009 Inhibition of AR-mediated transcription by binding of Oct1 to a motif enriched in AR-occupied regions.
18940312 2008 Population-based genome-wide association studies reveal six loci influencing plasma levels of liver enzymes.
18772384 2008 Global jumping and domain-specific intersegment transfer between DNA cognate sites of the multidomain transcription factor Oct-1.
18682386 2008 Histone 2B (H2B) expression is confined to a proper NAD+/NADH redox status.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18634911 2008 Analysis of the transcriptional regulation of the FABP2 promoter haplotypes by PPARgamma/RXRalpha and Oct-1.
18599544 2008 Expression of the muscle atrophy factor muscle atrophy F-box is suppressed by testosterone.
18550719 2008 Oct-1 induces pituitary tumor transforming gene expression in endocrine tumors.
18390905 2008 LOX-1 receptor blockade abrogates oxLDL-induced oxidative DNA damage and prevents activation of the transcriptional repressor Oct-1 in human coronary arterial endothelium.
18083338 2008 Octamer-binding transcription factor-1 gene is upregulated in primary varicose veins.
18030470 2008 Factors affecting sensitivity to antitumor platinum derivatives of human colorectal tumor cell lines.
17442950 2007 Production of specific mRNA transcripts, usage of an alternate promoter, and octamer-binding transcription factors influence the surface expression levels of the HIV coreceptor CCR5 on primary T cells.
17316622 2007 Oct-1 is involved in the transcriptional repression of the p15(INK4b) gene.
17273778 2007 Conserved POU-binding site linked to SP1-binding site within FZD5 promoter: Transcriptional mechanisms of FZD5 in undifferentiated human ES cells, fetal liver/spleen, adult colon, pancreatic islet, and diffuse-type gastric cancer.
17192276 2007 Regulation of NF-kappaB-dependent gene expression by the POU domain transcription factor Oct-1.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16360016 2006 Oct-1 DNA binding activity unresponsive to retinoblastoma protein expression prevents MHC class II induction in a non-small cell lung carcinoma cell line.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16301215 2005 T-13910 DNA variant associated with lactase persistence interacts with Oct-1 and stimulates lactase promoter activity in vitro.
16186125 2005 GATA-1 and Oct-1 are required for expression of the human alpha-hemoglobin-stabilizing protein gene.
16116232 2005 Regulation of basal and induced expression of C-reactive protein through an overlapping element for OCT-1 and NF-kappaB on the proximal promoter.
16002402 2005 The Groucho-related gene family regulates the gonadotropin-releasing hormone gene through interaction with the homeodomain proteins MSX1 and OCT1.
15831936 2005 Functional interaction of Oct transcription factors with the family of repeats in Epstein-Barr virus oriP.
15817654 2005 Silencing of Fshr occurs through a conserved, hypersensitive site in the first intron.
15786443 2005 Identification of hippocampus-related candidate genes for Alzheimer's disease.
15613485 2005 T to C substitution at -175 or -173 of the gamma-globin promoter affects GATA-1 and Oct-1 binding in vitro differently but can independently reproduce the hereditary persistence of fetal hemoglobin phenotype in transgenic mice.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15138251 2004 TALE homeodomain proteins regulate gonadotropin-releasing hormone gene expression independently and via interactions with Oct-1.
15105429 2004 Oct-1 maintains an intermediate, stable state of HLA-DRA promoter repression in Rb-defective cells: an Oct-1-containing repressosome that prevents NF-Y binding to the HLA-DRA promoter.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14645506 2003 STAT5 and Oct-1 form a stable complex that modulates cyclin D1 expression.
14612514 2003 Down-regulation of histone H2B by DNA-dependent protein kinase in response to DNA damage through modulation of octamer transcription factor 1.
14586402 2003 p53-independent induction of Gadd45 by histone deacetylase inhibitor: coordinate regulation by transcription factors Oct-1 and NF-Y.
14559893 2004 Molecular basis for synergistic transcriptional activation by Oct1 and Sox2 revealed from the solution structure of the 42-kDa Oct1.Sox2.Hoxb1-DNA ternary transcription factor complex.
14522952 2003 STAT3-dependent enhanceosome assembly and disassembly: synergy with GR for full transcriptional increase of the alpha 2-macroglobulin gene.
12923055 2003 Crystal structure of a POU/HMG/DNA ternary complex suggests differential assembly of Oct4 and Sox2 on two enhancers.
12887926 2003 S phase activation of the histone H2B promoter by OCA-S, a coactivator complex that contains GAPDH as a key component.
12887915 2003 Gene switching by metabolic enzymes--how did you get on the invitation list?
12853155 2003 The regulation of the Oct-1 gene transcription is mediated by two promoters.
12826401 2003 The herpes simplex virus VP16-induced complex: the makings of a regulatory switch.
12727885 2003 OBF1 enhances transcriptional potential of Oct1.
12672812 2003 Selective inhibition of class switching to IgG and IgE by recruitment of the HoxC4 and Oct-1 homeodomain proteins and Ku70/Ku86 to newly identified ATTT cis-elements.
12670868 2003 Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1.
12669425 2003 [Regulation of human oct-1 gene transcription involves two promotors].
12663137 2003 Human Oct-1L isoform has tissue-specific expression pattern similar to Oct-2.
12598320 2003 Expression of B-lymphocyte-associated transcription factors in human T-cell neoplasms.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446597 2002 Oct-1 is involved in the transcriptional repression of the gonadotropin-releasing hormone receptor gene.
12391146 2002 Oct-1 potentiates CREB-driven cyclin D1 promoter activation via a phospho-CREB- and CREB binding protein-independent mechanism.
12144930 2002 3-Hydroxy-3-methylglutaryl coenzyme A reductase inhibitors increase the binding activity and nuclear level of Oct-1 in mononuclear cells.
12019209 2002 Inflammatory bowel disease is associated with a TNF polymorphism that affects an interaction between the OCT1 and NF(-kappa)B transcription factors.
11997177 2002 Androgen receptor interactions with Oct-1 and Brn-1 are physically and functionally distinct.
11891224 2002 Cross-repression, a functional consequence of the physical interaction of non-liganded nuclear receptors and POU domain transcription factors.
11856838 2002 Crystallization of the Oct-1/SNAP190 peptide/DNA complex.
11777930 2002 BRCA1 regulates GADD45 through its interactions with the OCT-1 and CAAT motifs.
11380252 2001 Expression of the Oct-1 transcription factor and characterization of its interactions with the Bob1 coactivator.
11134019 2001 Silencing mediator for retinoid and thyroid hormone receptors interacts with octamer transcription factor-1 and acts as a transcriptional repressor.
10976766 2000 A set of proteins interacting with transcription factor Sp1 identified in a two-hybrid screening.
10779377 2000 Octamer transcription factor-1 enhances hepatic nuclear factor-1alpha-mediated activation of the human UDP glucuronosyltransferase 2B7 promoter.
10629049 2000 Mutations in host cell factor 1 separate its role in cell proliferation from recruitment of VP16 and LZIP.
10490647 1999 Developmental effects of ectopic expression of the glucocorticoid receptor DNA binding domain are alleviated by an amino acid substitution that interferes with homeodomain binding.
10480874 1999 Selective binding of steroid hormone receptors to octamer transcription factors determines transcriptional synergism at the mouse mammary tumor virus promoter.
10383413 1999 Functional interaction between Oct-1 and retinoid X receptor.
9889203 1999 HCF-dependent nuclear import of VP16.
9584182 1998 Recruitment of octamer transcription factors to DNA by glucocorticoid receptor.
9537509 1998 Interaction of Oct-1 and automodification domain of poly(ADP-ribose) synthetase.
9418884 1998 The large subunit of basal transcription factor SNAPc is a Myb domain protein that interacts with Oct-1.
9368058 1997 The cyclin-dependent kinase-activating kinase (CAK) assembly factor, MAT1, targets and enhances CAK activity on the POU domains of octamer transcription factors.
9242494 1997 Functions of the POU domain genes Skn-1a/i and Tst-1/Oct-6/SCIP in epidermal differentiation.
8668525 1996 The transcription factors Sp1 and Oct-1 interact physically to regulate human U2 snRNA gene expression.
8479524 1993 Solution structure of the POU-specific DNA-binding domain of Oct-1.
8462099 1993 The solution structure of the Oct-1 POU-specific domain reveals a striking similarity to the bacteriophage lambda repressor DNA-binding domain.
8454622 1993 Purification of the cellular C1 factor required for the stable recognition of the Oct-1 homeodomain by the herpes simplex virus alpha-trans-induction factor (VP16).
8314572 1993 Chromosomal structure and expression of the human OTF1 locus encoding the Oct-1 protein.
8227066 1993 Enhanced activation of the human histone H2B promoter by an Oct-1 variant generated by alternative splicing.
8202368 1994 The POU domains of the Oct1 and Oct2 transcription factors mediate specific interaction with TBP.
8156594 1994 Crystal structure of the Oct-1 POU domain bound to an octamer site: DNA recognition with tethered DNA-binding modules.
7945330 1994 The octamer motif present in the Rex-1 promoter binds Oct-1 and Oct-3 expressed by EC cells and ES cells.
7842742 1995 The human OTF1 locus which overlaps the CD3Z gene is located at 1q22-->q23.
7720710 1995 High mobility group protein 2 functionally interacts with the POU domains of octamer transcription factors.
7663141 1995 Solution structure of the Oct-1 POU homeodomain determined by NMR and restrained molecular dynamics.
7642649 1995 Interaction of Oct-1 with TFIIB. Implications for a novel response elicited through the proximal octamer site of the lipoprotein lipase promoter.
2905684 1988 The ubiquitous octamer-binding protein Oct-1 contains a POU domain with a homeo box subdomain.
2341156 1990 The gene for the ubiquitous octamer-binding protein Oct-1 is on human chromosome 1, region cen-q32, and near Ly-22 and Ltw-4 on mouse chromosome 1.
1887216 1991 Differential phosphorylation of the transcription factor Oct1 during the cell cycle.
1684878 1991 Mitotic phosphorylation of the Oct-1 homeodomain and regulation of Oct-1 DNA binding activity.