Property Summary

NCBI Gene PubMed Count 42
PubMed Score 94.35
PubTator Score 62.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
pancreatic cancer 1.200 3.8e-02
Barrett's esophagus 1.700 4.0e-02
cutaneous lupus erythematosus 4.100 1.7e-03
psoriasis -2.500 4.6e-05
osteosarcoma -7.929 2.5e-13
periodontitis 2.400 1.7e-32
medulloblastoma, large-cell 1.800 2.5e-04
non-small cell lung carcinoma 1.900 2.4e-13
X-linked agammaglobulinemia -1.664 8.8e-03
intraductal papillary-mucinous adenoma (... 3.200 1.9e-03
colon cancer -2.000 4.8e-02
lung cancer -2.800 1.3e-03
interstitial cystitis 2.900 5.4e-06
cystic fibrosis -1.300 1.5e-04
lung adenocarcinoma 2.600 1.5e-12
adult high grade glioma 1.200 1.9e-03
posterior fossa group B ependymoma 1.700 7.0e-06
primary Sjogren syndrome 1.800 2.9e-02
pancreatic carcinoma 1.200 3.8e-02
nasopharyngeal carcinoma -1.200 2.7e-03
lung carcinoma -1.100 2.5e-04
Breast cancer -1.200 4.2e-03
ulcerative colitis 4.100 1.8e-06
chronic rhinosinusitis -2.545 5.0e-03
head and neck cancer and chronic obstruc... -1.500 3.6e-02

Gene RIF (20)

PMID Text
26927796 these findings suggest a novel function of POU2AF1 as a potential regulator of host defense genes in the human airway epithelium.
24005100 It has been identified as a new disease susceptibility gene among Japanese. Though different from Europeans, it is indicated that a B lymphocyte differentiation route shares a common disease developing process. [Review]
23000144 Two significant susceptibility loci, TNFSF15 (rs4979462) and POU2AF1 (rs4938534) (combined odds ratio [OR] = 1.56, p = 2.84 x 10(-14) for rs4979462.
21905497 genetic polymorphism is associated with common variable immunodeficiency
21549311 Data show that Igh 3' enhancer-bound OCA-B and promoter-bound TFII-I mediate promoter-enhancer interactions, in both cis and trans, that are important for Igh transcription.
21424034 Twenty-two cases of nodular lymphocyte predominant Hodgkin lymphoma were studied for the immunohistochemical expression of Pax-5, Oct-2, BOB.1, Bcl-6 protein and MUM1/IRF-4.
20659471 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20141429 On multivariate analysis, co-expression of OCT-2/BOB.1 remained predictive for achievement of complete remission and increased risk of relapse.
20102401 BOB.1 may be helpful marker in the differential diagnosis of classical Hodgkin's lymphoma and primary mediastinal B-cell lymphoma
19913121 Observational study of gene-disease association. (HuGE Navigator)
18753146 Observational study of gene-disease association. (HuGE Navigator)
18695675 Oct-2 and its cofactor Bob-1 have an important function in mediating the IgH enhancer-bcl-2 promoter region interactions
17785371 Novel germ cell markers BOB1 were significantly upregulated in seminoma specimens, compared to normal testes.
16934875 Observational study of gene-disease association. (HuGE Navigator)
15796964 Alteration of the BOB1 locus does not correlate with its suppressed expression in Hodgkin lymphoma.
15672409 POU2AF1 was observed to be differentially expressed in the cells of patients with chronic lymphocytic leukemia.
14662861 OCA-B sustains expression of the immunoglobulin-secreting program when T lymphoma and plasmacytoma lines are fused, requiring Oct-2 coregulator for its function.
12727885 enhances transcriptional potential of Oct1
11907094 The expression of the octamer cofactor gene OBF-1 (Bob1/OCA-B) is sufficient to override the silencing effects of the B29 silencer, indicating that OBF-1 plays a critical role in B cell-specific B29 promoter expression.

AA Sequence

MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDM      1 - 70
EGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVL     71 - 140
TYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPI    141 - 210
SIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF                            211 - 256
//

Text Mined References (43)

PMID Year Title
26927796 2016 POU2AF1 Functions in the Human Airway Epithelium To Regulate Expression of Host Defense Genes.
24005100 2013 [Analysis of disease-pathway by susceptibility genes in primary biliary cirrhosis].
23291589 2013 Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus.
23000144 2012 Genome-wide association study identifies TNFSF15 and POU2AF1 as susceptibility loci for primary biliary cirrhosis in the Japanese population.
21905497 2011 Evaluation of CARMA1/CARD11 and Bob1 as candidate genes in common variable immunodeficiency.
21549311 2011 Direct interactions of OCA-B and TFII-I regulate immunoglobulin heavy-chain gene transcription by facilitating enhancer-promoter communication.
21424034 2011 B-cell transcription factors Pax-5, Oct-2, BOB.1, Bcl-6, and MUM1 are useful markers for the diagnosis of nodular lymphocyte predominant Hodgkin lymphoma.
20659471 2010 Genetic heterogeneity in colorectal cancer associations between African and European americans.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20141429 2010 OCT-2 expression and OCT-2/BOB.1 co-expression predict prognosis in patients with newly diagnosed acute myeloid leukemia.
20102401 2010 BOB.1, CD79a and cyclin E are the most appropriate markers to discriminate classical Hodgkin's lymphoma from primary mediastinal large B-cell lymphoma.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18753146 2008 Refinement of the basis and impact of common 11q23.1 variation to the risk of developing colorectal cancer.
18695675 2008 Functional long-range interactions of the IgH 3' enhancers with the bcl-2 promoter region in t(14;18) lymphoma cells.
17785371 2007 Novel germ cell markers characterize testicular seminoma and fetal testis.
16934875 2006 Linkage disequilibrium screening for multiple sclerosis implicates JAG1 and POU2AF1 as susceptibility genes in Europeans.
16713566 2006 Nontranscriptional regulation of SYK by the coactivator OCA-B is required at multiple stages of B cell development.
15796964 2005 Alterations of loci encoding PU.1, BOB1, and OCT2 transcription regulators do not correlate with their suppressed expression in Hodgkin lymphoma.
15672409 2005 Identification of a potential role for POU2AF1 and BTG4 in the deletion of 11q23 in chronic lymphocytic leukemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14662861 2003 Critical role for the Oct-2/OCA-B partnership in Ig-secreting cells.
14552839 2003 OCA-B regulation of B-cell development and function.
14515270 2003 The OBF-1 gene locus confers B cell-specific transcription by restricting the ubiquitous activity of its promoter.
12727885 2003 OBF1 enhances transcriptional potential of Oct1.
12672812 2003 Selective inhibition of class switching to IgG and IgE by recruitment of the HoxC4 and Oct-1 homeodomain proteins and Ku70/Ku86 to newly identified ATTT cis-elements.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12230975 2002 OcaB is required for normal transcription and V(D)J recombination of a subset of immunoglobulin kappa genes.
11907094 2002 Bob1 (OCA-B/OBF-1) differential transactivation of the B cell-specific B29 (Ig beta) and mb-1 (Ig alpha) promoters.
11483518 2001 Regulation of BOB.1/OBF.1 stability by SIAH.
11483517 2001 The RING finger protein Siah-1 regulates the level of the transcriptional coactivator OBF-1.
11380252 2001 Expression of the Oct-1 transcription factor and characterization of its interactions with the Bob1 coactivator.
11136971 2000 Synergism with the coactivator OBF-1 (OCA-B, BOB-1) is mediated by a specific POU dimer configuration.
10541551 1999 Crystal structure of an OCA-B peptide bound to an Oct-1 POU domain/octamer DNA complex: specific recognition of a protein-DNA interface.
9819426 1998 Coactivator OBF-1 makes selective contacts with both the POU-specific domain and the POU homeodomain and acts as a molecular clamp on DNA.
9632764 1998 Coactivation by OCA-B: definition of critical regions and synergism with general cofactors.
9442392 1997 The B cell-specific coactivator OBF-1 (OCA-B, Bob-1) is inducible in T cells and its expression is dispensable for IL-2 gene induction.
9211847 1997 Inducible expression and phosphorylation of coactivator BOB.1/OBF.1 in T cells.
8617501 1996 Assignment of the human gene for Oct-binding factor-1 (OBF1), a B-cell-specific coactivator of octamer-binding transcription factors 1 and 2, to 11q23.1 by somatic cell hybridization and in situ hybridization.
8574789 1995 Fusion of the LAZ3/BCL6 and BOB1/OBF1 genes by t(3; 11) (q27; q23) chromosomal translocation.
7859290 1995 OBF-1, a novel B cell-specific coactivator that stimulates immunoglobulin promoter activity through association with octamer-binding proteins.
7779176 1995 A B-cell coactivator of octamer-binding transcription factors.
7623806 1995 Cloning, functional characterization, and mechanism of action of the B-cell-specific transcriptional coactivator OCA-B.