Property Summary

NCBI Gene PubMed Count 102
PubMed Score 172.38
PubTator Score 377.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pituitary cancer -6.000 3.8e-17

Gene RIF (60)

PMID Text
26743473 Data identify silent subtype 3 adenomas as aggressive monomorphous plurihormonal adenomas of Pit-1 lineage that may be associated with hyperthyroidism, acromegaly or galactorrhea and amenorrhea.
25527274 Pit-1 regulates MMP-1 and MMP-13, and that inhibition of MMP-13 blocked invasiveness to lung in Pit-1-overexpressed breast cancer cells.
25500790 investigated the specific mutations in PROP1, POU1F1, LHX3, and HESX1 genes in patients with combined pituitary hormone deficiency (CPHD) in Turkey
24937538 These results suggest that the anti-PIT-1 antibody is not a cause but a marker of anti-PIT-1 antibody syndrome, in which cytotoxic T lymphocytes play a pivotal role in the pathogenesis.
22638072 New target genes of POU1F1 and downstream networks controlled by this factor.
22199144 Expression analysis of HMGA1, HMGA2 and PIT1 in human pituitary adenomas of different histological types revealed a direct correlation between PIT1 and HMGA expression levels.
22094313 HSII confers robust POU1F1-dependent activation of hGH-N in this system.
21761366 Data show no mutations in HESX1, PROP1, and POU1F1 genes, seven different mutations in CTNNB1 in 8/16 patients, and hyperexpression of miR-150.
21722153 This is the first report of a mutation at the exon 2 donor splice site of POU1F1, affecting TAD-R2.
21521297 study, which identifies a novel loss-of-function mutation in POU1F1, describes the phenotype of a rare condition in a patient followed from the first weeks of life to adulthood
21060149 Pit-1 overexpression or knockdown in human breast cancer cell lines induced profound phenotypic changes in the expression of proteins involved in cell proliferation, apoptosis, and invasion.
20810604 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20534763 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20395397 Data are consistent with recruitment and an early role for Pit-1 in remodeling of the growth hormone locus control region at the constitutively open hypersensitive site III through protein-protein interaction.
20381582 These results support the inference that W194XProp1 is unable to increase POU1F1 gene expression by the defect of transactivating domain and that S156insTProp1 is unable to increase due to the loss of DNA-binding activity.
19887646 Data suggest phosphorylation of Pit-1 (POU1F1) at T220 serves as a mechanism to modulate Pit-1 target genes by regulating binding of Pit-1 to monomeric (Pit-1) versus dimeric (Ets-1/Pit-1) sites on DNA
19808898 Pit-1 regulates mammary PRL transcription by binding to the proximal PRL promoter. Pit-1 raises cyclin D1 expression before increasing PRL levels. There was a significant correlation between Pit-1 & PRL expression in 94 invasive ductal breast carcinomas.
19609847 Novel association of two rare conditions Pit-1 mutation and lipoedema in a family that has not been described before.
19608642 Activation of Syt1 gene expression is part of a mechanism mediating POU1F-induced differentiation of pituitary cells.
19556346 analysis of a Pit-1beta 26-amino acid dominant and independent repressor domain
19453261 Observational study of gene-disease association. (HuGE Navigator)
19427323 These findings are consistent with a role for Pit-1 as an initiating factor in human growth hormone (hGH) locus activation during somatotrope ontogeny, acting through binding sites at the locus control region.
19369455 Our results suggested that there is a coordinated interrelationship between 2 key participants of Pi and PPi metabolism, ANKH and PiT-1.
18653712 The novel functioning binding elements of Prop1 in human Pit-1 gene.
18514160 Observational study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of POU class 1 homeobox 1 (POU1F1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18059085 novel POU1F1 splice site mutation, IVS4+1G>A, the first of its kind, in a Thai patient with combined pituitary hormone deficiency
17565274 Phosphate uptake via Pit-1 is required for osteochondrogenic phenotypic change and calcification of vascular smooth muscle cells in vitro.[review]
17456792 up-regulation of VDR transcription by Pit-1 is dependent on the presence of VDR protein
17047377 Review discusses the possibility that Pit-1-driven remodeling at nuclease-hypersensitive site (HS) III may precede that at HS I/II in the pituitary.
17021049 the Pit-1/Pit-1beta TADs are composed of multiple, modular, and transferable subdomains, including a regulatory R1 domain, a basal activation region, a selective inhibitory-Ras-responsive segment, and a beta-specific repressor domain
16901973 The growth-promoting effects of Pit-1 are at least partly due to the fact that this transcription factor prevents apoptotic cell death.
16879162 Review article uses Pit-1 as an example while exploring the role of transcription factors in pituitary hormone secretion, and examining mutations involved in human anterior pituitary pathologies.
16740974 findings show that activin negatively regulates the human Pit-1 gene promoter; activin effects on Pit-1 gene regulation are Smad independent and require the p38 MAPK pathway
16505001 Observational study of gene-disease association. (HuGE Navigator)
16322098 direct interaction between the vitamin D receptor (VDR) as homodimer (without the retinoid X receptor), and the Pit-1 promoter, supporting the view that Pit-1 is a direct transcriptional target of VDR
16263824 CBP/p300 recruitment and Pit-1 dimerization are necessary for Pit-1 target gene activation and are important in the pathogenesis of combined pituitary hormone deficiency
16214911 Observational study of gene-disease association. (HuGE Navigator)
16133148 Data suggest that the expression of Pit-1 in cells of the alpha SU-based gonadotropin cell lineage might also lead to the expression of growth hormone, prolactin, and thyroid-stimulating hormone beta subunit.
16061841 depending on its level of expression, Pit-1 may be involved in normal mammary development, breast disorders, or both
16030140 The redistribution of co-repressor complexes by Pit-1 might represent an important mechanism by which transcription factors direct changes in cell-specific gene expression.
15998782 Findings are consistent with the existence of LHX4-driven pathway leading to expression of GH through transcriptional activation of POU1F1. They argue against dominant-negative effect of mutant LHX4 proteins over normal LHX4.
15928241 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15928241 the phenotype associated with POU1F1 mutations may be more variable, with the occasional preservation of TSH secretion in pituitary deficiency disease
15031321 the smad pathway and the tumor suppressor menin are key regulators of activin effects on PRL and Pit-1 expression, as well as on cell growth inhibition
14714741 "Mutations within POUF1 or P1T1 are associated with growth hormone, thyroid stimulating hormone and prolactin deficiency..." p. 207
14646405 "PIT1 mutations in man are associated with ...thyroid stimulating hormone and growth hormone deficiency..." p. 278
12932747 New mutation located in the N-terminal (Q-4ter) of PIT-1 gene causing recessive combined pitutary hormone deficiency.
12773133 that phenotypically normal cases have been reported with this mutation, our results deny the relationship between R271W and combined pituitary hormone deficiency.
12717343 Pit-1 which is required for generation of hormone producing cells in the anterior pituitary gland, have proved to be important in the cause of hypopituitarism in humans--REVIEW
12242337 phosphorylation of Pit-1 affects binding to transcription factor Ets-1
12223489 full responsiveness to several signaling pathways regulating the hPRL promoter requires the B2 Pitx binding site and that Pitx factors may be part of the proteic complex involved in these regulations
12200420 found that codon 24 proline in the transactivation domain as well as the POU domain of Pit-1 was crucial to recruit coactivator CREB-binding protein (CBP) for the expression of Pit-1-targeted genes.
12189206 specification of unique Pit-1 activity in the hGH locus control region
12165656 silence in silent thyrotroph adenomas seems to be downstream to transcription of Pit-1 gene in the pathway leading to hormone secretion
11924936 the clinical presentation of the PIT1 mutation involves intrauterine growth retardation
11847467 severe hypothyroidism and combined pituitary hormone deficiency due to a new mutation in the PIT-1 gene. the newly described mutation is inherited in an autosomal-recessive way.

AA Sequence

MSCQAFTSADTFIPLNSDASATLPLIMHHSAAECLPVSNHATNVMSTATGLHYSVPSCHYGNQPSTYGVM      1 - 70
AGSLTPCLYKFPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFK     71 - 140
VRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGA    141 - 210
NERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSL    211 - 280
FSISKEHLECR                                                               281 - 291
//

Text Mined References (105)

PMID Year Title
26743473 2016 Silent subtype 3 pituitary adenomas are not always silent and represent poorly differentiated monomorphous plurihormonal Pit-1 lineage adenomas.
26612202 2016 Functional characterization of a human POU1F1 mutation associated with isolated growth hormone deficiency: a novel etiology for IGHD.
25527274 2014 Cancer progression by breast tumors with Pit-1-overexpression is blocked by inhibition of metalloproteinase (MMP)-13.
25500790 2015 Molecular analysis of PROP1, POU1F1, LHX3, and HESX1 in Turkish patients with combined pituitary hormone deficiency: a multicenter study.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25158072 2015 Cross-disorder genome-wide analyses suggest a complex genetic relationship between Tourette's syndrome and OCD.
24937538 2014 Involvement of PIT-1-reactive cytotoxic T lymphocytes in anti-PIT-1 antibody syndrome.
22638072 2012 Research resource: A genome-wide study identifies potential new target genes for POU1F1.
22199144 2012 PIT1 upregulation by HMGA proteins has a role in pituitary tumorigenesis.
22094313 2012 POU1F1-mediated activation of hGH-N by deoxyribonuclease I hypersensitive site II of the human growth hormone locus control region.
22010633 2012 Two novel mutations in the POU1F1 gene generate null alleles through different mechanisms leading to combined pituitary hormone deficiency.
21761366 2010 CTNNB1 gene mutations, pituitary transcription factors, and MicroRNA expression involvement in the pathogenesis of adamantinomatous craniopharyngiomas.
21722153 2012 Identification of a novel mutation in the exon 2 splice donor site of the POU1F1/PIT-1 gene in Japanese identical twins with mild combined pituitary hormone deficiency.
21521297 2011 A novel POU1F1 mutation (p.Thr168IlefsX7) associated with an early and severe form of combined pituitary hormone deficiency: functional analysis and follow-up from infancy to adulthood.
21060149 2010 Deregulation of the Pit-1 transcription factor in human breast cancer cells promotes tumor growth and metastasis.
20810604 2010 Eighteen insulin-like growth factor pathway genes, circulating levels of IGF-I and its binding protein, and risk of prostate and breast cancer.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20534763 2010 Mutation and gene copy number analyses of six pituitary transcription factor genes in 71 patients with combined pituitary hormone deficiency: identification of a single patient with LHX4 deletion.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20395397 2010 Appearance of the pituitary factor Pit-1 increases chromatin remodeling at hypersensitive site III in the human GH locus.
20381582 2010 W194XProp1 and S156insTProp1, both of which have intact DNA-binding domain, show a different DNA-binding activity to the Prop1-binding element in human Pit-1 gene.
19887646 2010 A Pit-1 threonine 220 phosphomimic reduces binding to monomeric DNA sites to inhibit Ras and estrogen stimulation of the prolactin gene promoter.
19808898 2010 The Pit-1/Pou1f1 transcription factor regulates and correlates with prolactin expression in human breast cell lines and tumors.
19609847 2010 Pit-1 mutation and lipoedema in a family.
19608642 2009 Expression of the synaptotagmin I gene is enhanced by binding of the pituitary-specific transcription factor, POU1F1.
19556346 2009 The 26-amino acid beta-motif of the Pit-1beta transcription factor is a dominant and independent repressor domain.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19427323 2009 Expression of Pit-1 in nonsomatotrope cell lines induces human growth hormone locus control region histone modification and hGH-N transcription.
19369455 2009 The CPPDD-associated ANKH M48T mutation interrupts the interaction of ANKH with the sodium/phosphate cotransporter PiT-1.
18653712 2008 Identification and analysis of prophet of Pit-1-binding sites in human Pit-1 gene.
18514160 2008 Phosphodiesterase 8B gene variants are associated with serum TSH levels and thyroid function.
18059085 2008 A novel germline mutation, IVS4+1G>A, of the POU1F1 gene underlying combined pituitary hormone deficiency.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17565274 2007 Sodium-dependent phosphate cotransporters and vascular calcification.
17456792 2007 Cellular expression levels of the vitamin D receptor are critical to its transcriptional regulation by the pituitary transcription factor Pit-1.
17047377 2006 Regulation of the human growth hormone gene family: possible role for Pit-1 in early stages of pituitary-specific expression and repression.
17021049 2007 Differential utilization of transcription activation subdomains by distinct coactivators regulates Pit-1 basal and Ras responsiveness.
16968807 2006 Identification and functional analysis of the novel S179R POU1F1 mutation associated with combined pituitary hormone deficiency.
16901973 2006 Involvement of the pituitary-specific transcription factor pit-1 in somatolactotrope cell growth and death: an approach using dominant-negative pit-1 mutants.
16879162 2006 Pituitary transcription factors: from congenital deficiencies to gene therapy.
16740974 2006 Activin inhibits the human Pit-1 gene promoter through the p38 kinase pathway in a Smad-independent manner.
16505001 2006 Positive association between POU1F1 and mental retardation in young females in the Chinese Han population.
16322098 2006 The vitamin D receptor represses transcription of the pituitary transcription factor Pit-1 gene without involvement of the retinoid X receptor.
16263824 2006 The role of CBP/p300 interactions and Pit-1 dimerization in the pathophysiological mechanism of combined pituitary hormone deficiency.
16214911 2005 Genetic variation in the growth hormone synthesis pathway in relation to circulating insulin-like growth factor-I, insulin-like growth factor binding protein-3, and breast cancer risk: results from the European prospective investigation into cancer and nutrition study.
16133148 2005 Induction of GH, PRL, and TSH beta mRNA by transfection of Pit-1 in a human pituitary adenoma-derived cell line.
16061841 2005 Pit-1 is expressed in normal and tumorous human breast and regulates GH secretion and cell proliferation.
16030140 2005 Functional interactions with Pit-1 reorganize co-repressor complexes in the living cell nucleus.
15998782 2005 Functional relationship between LHX4 and POU1F1 in light of the LHX4 mutation identified in patients with pituitary defects.
15928241 2005 Novel mutations within the POU1F1 gene associated with variable combined pituitary hormone deficiency.
15031321 2004 Activin inhibits pituitary prolactin expression and cell growth through Smads, Pit-1 and menin.
14714741 2003 Borjeson-Forssman-Lehmann syndrome: a novel pituitary phenotype due to mutation in a novel gene.
14646405 2003 Clinical characteristics and molecular analysis of PIT1, PROP1,LHX3, and HESX1 in combined pituitary hormone deficiency patients with abnormal pituitary MR imaging.
12932747 2003 New N-terminal located mutation (Q4ter) within the POU1F1-gene (PIT-1) causes recessive combined pituitary hormone deficiency and variable phenotype.
12773133 2003 The R271W mutant form of Pit-1 does not act as a dominant inhibitor of Pit-1 action to activate the promoters of GH and prolactin genes.
12717343 2003 Cellular determination in the anterior pituitary gland: PIT-1 and PROP-1 mutations as causes of human combined pituitary hormone deficiency.
12629113 2003 A novel nonsense mutation in the Pit-1 gene: evidence for a gene dosage effect.
12612071 2003 Dominant negative dimerization of a mutant homeodomain protein in Axenfeld-Rieger syndrome.
12242337 2002 Structural characterization of the PIT-1/ETS-1 interaction: PIT-1 phosphorylation regulates PIT-1/ETS-1 binding.
12223489 2002 Pitx factors are involved in basal and hormone-regulated activity of the human prolactin promoter.
12200420 2002 Novel function of the transactivation domain of a pituitary-specific transcription factor, Pit-1.
12189206 2002 Specification of unique Pit-1 activity in the hGH locus control region.
12165656 2002 Expression of Pit-1 and growth hormone-releasing hormone receptor mRNA in human pituitary adenomas: difference among functioning, silent, and other nonfunctioning adenomas.
11924936 2002 A novel mutation in PIT-1: phenotypic variability in familial combined pituitary hormone deficiencies.
11891224 2002 Cross-repression, a functional consequence of the physical interaction of non-liganded nuclear receptors and POU domain transcription factors.
11847467 2001 A new C-terminal located mutation (V272ter) in the PIT-1 gene manifesting with severe congenital hypothyroidism. Possible functionality of the PIT-1 C-terminus.
11301317 2001 Identification of a dominant negative homeodomain mutation in Rieger syndrome.
11297581 2001 Combined pituitary hormone deficiency caused by compound heterozygosity for two novel mutations in the POU domain of the Pit1/POU1F1 gene.
11222742 2001 Combined pituitary hormone deficiency due to the F135C human Pit-1 (pituitary-specific factor 1) gene mutation: functional and structural correlates.
10549299 1999 Transcription factors regulating pituitary development.
10367888 1999 Reciprocal interactions of Pit1 and GATA2 mediate signaling gradient-induced determination of pituitary cell types.
9751061 1998 Signal-specific co-activator domain requirements for Pit-1 activation.
9685346 1998 The molecular basis of Rieger syndrome. Analysis of Pitx2 homeodomain protein activities.
9639565 1998 Nuclear factor 1 regulates the distal silencer of the human PIT1/GHF1 gene.
9626142 1998 Pro239Ser: a novel recessive mutation of the Pit-1 gene in seven Middle Eastern children with growth hormone, prolactin, and thyrotropin deficiency.
9588494 1998 Description of a Brazilian patient bearing the R271W Pit-1 gene mutation.
9485179 1998 Central hypothyroidism reveals compound heterozygous mutations in the Pit-1 gene.
9482665 1998 Structure and regulation of the human growth hormone-releasing hormone receptor gene.
9426156 1997 The glucocorticoid receptor inhibits the human prolactin gene expression by interference with Pit-1 activity.
9392392 1997 Pituitary dwarfism in the R271W Pit-1 gene mutation.
9032233 1997 Interaction of Ets-1 and the POU-homeodomain protein GHF-1/Pit-1 reconstitutes pituitary-specific gene expression.
8768831 1996 A new mutation of the gene encoding the transcription factor Pit-1 is responsible for combined pituitary hormone deficiency.
8755540 1996 P-OTX: a PIT-1-interacting homeodomain factor expressed during anterior pituitary gland development.
8663380 1996 The c-Jun delta-domain inhibits neuroendocrine promoter activity in a DNA sequence- and pituitary-specific manner.
8458380 1993 The transcription factor Pit-1/GHF-1 is expressed in hemopoietic and lymphoid tissues.
8370519 1993 Identification of a novel zinc finger protein binding a conserved element critical for Pit-1-dependent growth hormone gene expression.
8346040 1993 Cloning of a human GHF-1/Pit-1 cDNA variant.
8027225 1994 Pit-1 gene expression in the human pituitary and pituitary adenomas.
7852536 1995 A "hot spot" in the Pit-1 gene responsible for combined pituitary hormone deficiency: clinical and molecular correlates.
7833912 1994 Monoallelic expression of normal mRNA in the PIT1 mutation heterozygotes with normal phenotype and biallelic expression in the abnormal phenotype.
7721104 1995 A novel pituitary transcription factor is produced by alternative splicing of the human GHF-1/PIT-1 gene.
7670563 1995 A novel E250X mutation of the PIT1 gene in a patient with combined pituitary hormone deficiency.
7608249 1995 Expression of pit-1 messenger ribonucleic acid and protein in the human placenta.
7593413 1995 The prenatal role of thyroid hormone evidenced by fetomaternal Pit-1 deficiency.
3215510 1988 The POU domain: a large conserved region in the mammalian pit-1, oct-1, oct-2, and Caenorhabditis elegans unc-86 gene products.
2902927 1988 The pituitary-specific transcription factor GHF-1 is a homeobox-containing protein.
2739723 1989 Expression of a large family of POU-domain regulatory genes in mammalian brain development.
1956794 1991 Cloning of the human cDNA for transcription factor Pit-1.
1509263 1992 Mutation of the POU-specific domain of Pit-1 and hypopituitarism without pituitary hypoplasia.
1509262 1992 A mutation in the POU-homeodomain of Pit-1 responsible for combined pituitary hormone deficiency.
1487156 1992 Characterization of the gene encoding human pituitary-specific transcription factor, Pit-1.
1472057 1992 Mutations in the Pit-1 gene in children with combined pituitary hormone deficiency.
1370379 1992 Nucleotide sequence of the complementary DNA for human Pit-1/GHF-1.
1302000 1992 Cretinism with combined hormone deficiency caused by a mutation in the PIT1 gene.