Property Summary

NCBI Gene PubMed Count 106
PubMed Score 177.87
PubTator Score 377.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Pituitary hypoplasia 23
Hypothyroidism 122
Abdomen distended 43
Abnormal prolactin level 7
Abnormality of secondary sexual hair 6
Abnormality of the hypothalamus-pituitary axis 12
Anterior pituitary agenesis 6
Anterior pituitary hypoplasia 13
Anteverted nostril 191
Aplasia/Hypoplasia of the breasts 10
Autosomal recessive predisposition 1442
Bulging forehead 66
Central hypothyroidism 6
Cleft palate with cleft lip 23
Coarse facial features 108
Cognitive delay 608
Concave bridge of nose 195
Constipation 181
Decreased circulating ACTH level 12
Decreased projection of midface 105
Depressed nasal bridge 195
Depressed nasal ridge 51
Depressed nasal root/bridge 195
Dull intelligence 645
Dyschezia 135
Enophthalmos 75
Fatigue 182
Feeding difficulties 127
Frontal bossing 157
Generalized osteopenia 99
Global developmental delay 608
Hypoglycemia 152
Hypogonadism, Isolated Hypogonadotropic 71
Hypogonadotropic hypogonadism 89
Hypotension 82
Hypotrophic malar bone 129
Hypotrophic midface 105
Icterus 82
Infertility 188
Intellectual disability 1016
Isolated Growth Hormone Deficiency, Type II 2
Large bregma sutures 46
Large fontanelle 46
Large, late-closing fontanelle 46
Late fontanel closure 28
Low intelligence 645
Macroglossia 65
Malar flattening 129
Mental Retardation 645
Mental and motor retardation 608
Mental deficiency 645
Midface retrusion 105
Muscle hypotonia 571
Neonatal Jaundice 30
Oral cleft 18
Osteopenia 99
Pituitary Dwarfism Type 3 3
Pituitary dwarfism 6
Poor school performance 645
Prolonged neonatal jaundice 17
Prominent forehead 66
Secondary hypothyroidism 15
Septo-Optic Dysplasia 11
Severe postnatal growth retardation 16
Short nose 132
Short stature 531
Sleep disturbances 37
Small midface 105
Small nose 132
Small testicle 75
Sunken eyes 63
Thickened facial skin with coarse facial features 108
Umbilical hernia 93
Wide bregma sutures 46
menstrual periods stopped for over 6 months 13
Disease Target Count P-value
pituitary cancer 1972 3.8e-17
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Panhypopituitarism 14 0.0 5.0

Expression

  Differential Expression (1)

Disease log2 FC p
pituitary cancer -6.000 3.8e-17

Gene RIF (65)

AA Sequence

MSCQAFTSADTFIPLNSDASATLPLIMHHSAAECLPVSNHATNVMSTATGLHYSVPSCHYGNQPSTYGVM      1 - 70
AGSLTPCLYKFPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFK     71 - 140
VRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGA    141 - 210
NERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSL    211 - 280
FSISKEHLECR                                                               281 - 291
//

Text Mined References (109)

PMID Year Title