Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

 Compartment GO Term (0)

AA Sequence

MVAEVSPKLAASPMKKPFGFRGKMGKWCCCCFPCCRGSGKNNMGAWRDHDDSAFTEPRYHVRREDLGKLH      1 - 70
RAAWWGEVPRADLIVMLRGPGINKRDKKKRTALHLACANGNSEVVSLLLDRQCQLHVFDSKKRTALIKAV     71 - 140
QCQEDECALMLLQHGTDPNLPDMYGNTALHYAVYNEDKLMAKTLLLYGADIESKNKGGLTPLLLAVHGQK    141 - 210
QRMVKFLIKKKANLNALDRFGRTALILAVRCGSASIVSLLLQQNIDVFSQDVFGQTAEDYAVSSHHSIIC    211 - 280
QLLSDYKENQMPNNSSGNSNPEQDLKLTSEEEPQRLKGSENSQHEKVTQEPDINKDCDREVEEEMQKHGS    281 - 350
NNVGLSENLTDGAAAGNGDGGLVPQRKSRKHENQQFPNTEIEEYHRPEKKSNEKNKVKSQIHSVDNLDDI    351 - 420
TWPSEIASEDYDLLFSNYETFTLLIEQLKMDFNDSASLSKIQDAVISEEHLLELKNSHYEQLTVEVEQME    421 - 490
NMVHVLQK                                                                  491 - 498
//

Text Mined References (4)

PMID Year Title