Property Summary

NCBI Gene PubMed Count 135
PubMed Score 103.66
PubTator Score 1006.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.200 2.3e-05
psoriasis 2.600 2.1e-05
astrocytoma 1.300 2.5e-02
tuberculosis and treatment for 6 months -1.300 3.4e-06
pancreatic ductal adenocarcinoma liver m... -2.101 1.6e-02
ovarian cancer 1.200 1.4e-03
pituitary cancer -1.500 6.4e-05

Gene RIF (89)

PMID Text
26669712 P450 (Cytochrome) Oxidoreductase Gene (POR) Common Variant (POR*28) Significantly Alters CYP2C9 Activity in Swedish, But Not in Korean Healthy Subjects
26580670 the POR g.6593A>G polymorphism significantly influences CYP2B6 activity
26544874 POR besides CYP2B6 can influence cyclophosphamide metabolism
26297733 POR is the main determinant of SN30000 sensitivity in 3 different genetic backgrounds. Head and neck squamous cell carcinomas showed heterogeneous POR expression. There may be a relationship between HPV status and hypoxia-activated prodrug sensitivity.
26123203 POR A503V might decrease the risk of bladder cancer by reducing its metabolic activity.
26087061 electron transfer between mCPR and aromatase
26067485 This study confirmed that CYP3A5*1 was associated with lower tacrolimus trough concentrations. POR*28 was associated with decreased tacrolimus trough concentrations although the effect was small possibly through enhanced CYP3A4 enzyme activity.
25809265 Study is a thorough structural, dynamic, and thermodynamic characterization of the soluble form of human microsomal CPR using small-angle x-ray scattering and nuclear magnetic resonance spectroscopy under various conditions
25728647 Transient kinetic dissection of the reaction of POR with NADPH and the reduction in cytochrome c by POR using stopped-flow techniques revealed defects in individual electron transfer steps mediated by A287P.
25712184 We identified seven unreported SNP genetic variations. The p.Pro384Leu variant exhibited reduced enzymatic activities compared with wild-type.
25521355 In children with FH, carriage of POR*28 allele is associated with reduced effect of atorvastatin on TChol and LDLc and therefore identifies FH children that may require higher atorvastatin doses to achieve full therapeutic benefits
25495409 The ABCB1 was significantly associated with the CDR . CYP3A4*1G and CYP3A5*3 could influence CBZ metabolism, while POR*28 had no effect on it. The EPHX1 were significantly associated with CBZD:CBZE ratio.
25322286 Results show that combining the CYP3A5*1, POR*28 and CYP3A4*22 genotypes allows partial differentiation of early tacrolimus dose requirements and the time to reach therapeutic target concentrations after transplantation.
25196843 Interactions of HO-2 with CPR and BVR, were evaluated.
24642534 NADPH-cytochrome P450 reductase is regulated by all-trans retinoic acid and by 1,25-dihydroxyvitamin D3 in human acute myeloid leukemia cells.
24589657 Reciprocal active site substitutions in CPR (H322A) and MSR (A312H) were created. Interflavin electron transfer was inhibited in CPR H322A and accelerated in MSR A312H.
24491563 Findings regarding the interaction of NADPH-P450 reductase (NPR) with cellular stress response (CSR) indicated function of NPR in hypoxic response.
24465960 Seventeen SNPs of CYP3A5, CYP3A4, COMT, IL-10 and POR were identified.
24464600 POR*28 allele is an important source of CYP2C9 activity variability and combined with CYP2C9 gene poly-morphisms may explain individual variability in the effect of sulfonylureas.
24448396 results show that FMO3 E158K and POR A503V polymorphisms are minor sources of nicotine metabolism variation, insufficient to appreciably alter smoking.
24430948 Data shows that POR*28 allele was not associated with the lipid-lowering effect of atorvastatin.
24345815 results showed that the CYP2C19 and/or P450 oxidoreductase genotypes have an impact on the clearance of clobazam and/or N-desmethylclobazam
24196959 although POR expression is a potential biomarker of sensitivity to some HAP, identification of other one-electron reductases responsible for HAP activation is needed for their rational clinical development.
24113216 Candidate-gene study shows that polymorphisms in PPARalpha and POR might predispose patients being treated with tacrolimus to the development of NODAT after kidney transplantation
23911089 Domain motion is linked closely to the individual steps of the catalytic cycle of cytochrome P450 reductase.
23832577 The role of Cytochrome P450 reductase is to provide electrons to a redox partner, the interactions with cytochrome P450 2D6 (2D6) were investigated and a possible complex structure is suggested.
23353702 Structural, enzymatic and clinical implications of the NADPH P450 oxidoreductase mutations linked to newly identified disorders in humans, now categorized as POR deficiency[review].
22547083 POR genetic variants affect CYP2C9 activities. The impact of a POR variant on catalysis varies with the isoform of CYP2C9 and the assay substrate.
22545110 NADPH cytochrome P450 reductase prevents this translocation and promotes oligomerization of HO-1.
22462747 Six novel NADPH-P450 oxidoreductase missense variants in Ashkenazi and Moroccan Jewish populations were identified.
22177374 POR*28 C > T polymorphism increases 1-hydroxylation of midazolam after intravenous administration. The polymorphism is associated with increased hepatic, but not intestinal, CYP3A activity in healthy Chinese volunteers.
22162478 Clinical, biochemical, and genetic findings in a large PORD cohort.
21973081 The data suggested that cytochrome P450 reductase plays a major role in reactive oxygen species generation by liver cells under the basal conditions, but a minimal rike during simulated in vitro ischemia-reperfusion injury.
21900384 The results suggest that the SP1 binding sites constitute an essential element of the POR proximal promoter.
21843508 a novel POR mutation P399_E401del in two unrelated Turkish patients with 46,XX disorder of sexual development was found.
21770725 These data indicate that the POR*28 SNP is associated with additional increases in early tacrolimus dose-requirements in patients carrying a CYP3A5*1 allele.
21762695 Studies indicate that electron transfer in cytochrome P450 reductase is conformationally gated.
21741353 human POR mutations, shown to impact P450 activities, also result in varying degrees of diminished HO-1 activity, which may further complicate CYPOR deficiency.
21726529 this study provides novel insights into the regulation of gap junction function by CYPOR and suggests that Cx43 may play an important role(s) in CYPOR-mediated bone defects seen in patients.
21655236 Results reveal unusual biochemical differences between mosquito CPR and the human form in the binding of small molecules that may aid the development of 'smart' insecticides and synergists that selectively target mosquito CPR.
21393444 the human P450 (cytochrome) oxidoreductase gene transcription is regulated by thyroid hormone receptor beta and Smad3/4
21265736 investigation of influence of domain interfaces on various internal and external electron transfer rates, redox potentials of cofactors (FMN/FAD), and global geometry of the enzyme
21164260 POR variants may also affect skeletal development and drug metabolism.
21084761 we identified 75 genetic variations in the POR gene including 26 novel ones from 235 Japanese subjects. Four novel variations resulted in amino acid substitutions.
21084761 Observational study of genotype prevalence. (HuGE Navigator)
21070833 POR is probably an important contributor to genetic variation in both steroidogenesis and drug metabolism
20940534 Cytochrome P450 oxidoreductase genetic variants have different effects on catalysis by CYP2D6 that depend on the substrate being metabolized.
20879989 kinetic studies of catalytic interaction with CYP3A4 in liposomes; data support model in which 1st electron transfer takes place within relatively stable CPR-CYP3A4 complex then complex dissociates/reforms between 1st & 2nd electron transfers
20849814 report mutations in POR in patients with disordered steroidogenesis/Antley-Bixler syndrome may reduce CYP3A4 activity; POR mutants Y181D, A457H, Y459H, V492E, R616X had over 99% loss of CYP3A4 activity; mutations A287P, C569Y, V608F lost 60-85% activity
20844025 Our results provide in vivo evidence for an important role of POR in regulating drug metabolism and detoxification.
20732302 mutations in POR found in patients with congenital adrenal hyperplasia may reduce HO-1 activity, potentially influencing heme catabolism in individuals carrying mutant POR alleles.
20722625 Report co-expression of recombinant human CYP2C9 with human cytochrome P450 reductase in protease deficient S. cerevisiae strain at a higher scale yields an enzyme of higher specific activity.
20697309 POR variants affect CYP3A4 activities.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20096935 Results indicate that residues in the C-helix of cytochrome P450 2B6 play a major role in the interaction with NADPH-cytochrome P450 reductase.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19884324 study concludes that compromised FMN binding is the specific molecular defect causing POR deficiency in patients with Y181D mutation and that this defect, in large part, can be overcome in vitro by FMN addition
19858215 Domain motion in cytochrome P450 reductase: conformational equilibria revealed by NMR and small-angle x-ray scattering.
19837910 study describes 4 patients with POR deficiency & characterizes activities of their mutations; all were compound heterozygotes for POR mutations, including 5 novel mutations: L577R, N185K, delE217, and frameshift mutations 1363delC 7 697-698insGAAC
19805543 Data support the formation of P450c17, P450arom, and CPR homodimers and oligomers in lipid bilayers.
19744540 Results describe a model of the structure of human P450 oxidoreductase created by in silico amino acid replacements in the rat POR crystal structure.
19598235 Observational study of gene-disease association. (HuGE Navigator)
19374516 Observational study of gene-disease association. (HuGE Navigator)
19258400 Observational study of gene-disease association. (HuGE Navigator)
19161969 CPR's putative membrane topology indicates that the Q153R and R316W missense mutations found in patients with disordered steroidogenesis are located within the membrane-associated regions.
18681889 Experiments using excess NADPH over cytochrome P450 reductase provide evidence that both pH and solvent significantly influence the kinetic exposure of the blue di-semiquinone intermediate, yet the observed rate constants are essentially pH independent.
18630181 patients with Antley-Bixler-like skeletal anomalies, but with mutations in the POR gene and disordered steroidogenesis, represent a new disorder called POR deficiency.
18559916 POR deficiency can masquerade clinically as isolated 17,20-lyase deficiency.
18551037 Observational study of gene-disease association. (HuGE Navigator)
18397975 The common P450 oxidoreductase variant A503V is not a modifier gene for 21-hydroxylase deficiency.
18397975 Observational study of gene-disease association. (HuGE Navigator)
18259105 The prognosis for patients with POR deficiency appears to depend on the severity of the bony malformations and their timely treatment.
18230729 The POR gene in a representative population of 842 healthy unrelated individuals in four ethnic groups was sequenced and compared.
18216718 Observational study of gene-disease association. (HuGE Navigator)
17881660 TG100435 and TG100855 were interconverted metabolically. FMO3 seem to be the major N-oxidizing enzyme, whereas cytochrome P450 reductase seems to be responsible for the retroreduction reaction.
17827787 Observational study of genotype prevalence. (HuGE Navigator)
17635179 clinical, structural and functional implications of mutations and polymorphisms in POR
17595315 Mutations R457H and V492E located in the FAD domain of NADPH P450 oxidoreductase (POR) that disrupt electron transfer caused a complete loss of CYP19A1 activity.
17580970 The energetics of 2',5'-ADP binding to the FAD-binding domain of cytochrome P450 reductase were characterized.
17505056 A287P homozygous patients had preferential inhibition of CYP17A1, whereas Steroid 21-Hydroxylase retained near normal activity.
17440066 Observational study of gene-disease association. (HuGE Navigator)
17440066 data suggest that African Americans harbor an allele at the POR locus that may increase breast cancer risk
17018578 Antticancer activity of motexafin gadolinium may involve inhibition of this enzyme.
16998238 analysis of FAD binding in the Y459H and V492E Antley-Bixler syndrome mutants of human cytochrome P450 reductase
16467261 POR deficiency is a new disease, distinct from the craniosynostosis syndromes caused by FGFR mutations.
15666840 POR deficiency is a new disorder of adrenal and gonadal steroidogenesis that affects all microsomal cytochrome P450 enzymes, hence may have important implications for genetic differences in drug metabolism.
15220035 Molecular pathogenesis of this form of congenital adrenal hyperplasia is caused by mutations in the gene encoding P450 oxidoreductase
12787027 role of coenzyme binding in regulating interflavin electron transfer in human cytochrome P450 reductase
11971899 activation of HIF-1 is modulated by cytochrome P-450 reductase in cell membrane

AA Sequence

MGDSHVDTSSTVSEAVAEEVSLFSMTDMILFSLIVGLLTYWFLFRKKKEEVPEFTKIQTLTSSVRESSFV      1 - 70
EKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEYDLADLSSLPEIDNALVVFCMATY     71 - 140
GEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKTYEHFNAMGKYVDKRLEQLGAQRIFELGLGDDDG    141 - 210
NLEEDFITWREQFWPAVCEHFGVEATGEESSIRQYELVVHTDIDAAKVYMGEMGRLKSYENQKPPFDAKN    211 - 280
PFLAAVTTNRKLNQGTERHLMHLELDISDSKIRYESGDHVAVYPANDSALVNQLGKILGADLDVVMSLNN    281 - 350
LDEESNKKHPFPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPSEQELLRKMASSSGEGKELYLSWV    351 - 420
VEARRHILAILQDCPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVVVEYETKAGRINKGVA    421 - 490
TNWLRAKEPAGENGGRALVPMFVRKSQFRLPFKATTPVIMVGPGTGVAPFIGFIQERAWLRQQGKEVGET    491 - 560
LLYYGCRRSDEDYLYREELAQFHRDGALTQLNVAFSREQSHKVYVQHLLKQDREHLWKLIEGGAHIYVCG    561 - 630
DARNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTKGRYSLDVWS                           631 - 677
//

Text Mined References (141)

PMID Year Title
26669712 2015 P450 (Cytochrome) Oxidoreductase Gene (POR) Common Variant (POR*28) Significantly Alters CYP2C9 Activity in Swedish, But Not in Korean Healthy Subjects.
26580670 2016 Effects of the selected cytochrome P450 oxidoreductase genetic polymorphisms on cytochrome P450 2B6 activity as measured by bupropion hydroxylation.
26544874 2015 Cytochrome P450 Oxidoreductase Influences CYP2B6 Activity in Cyclophosphamide Bioactivation.
26297733 2015 Identification of P450 Oxidoreductase as a Major Determinant of Sensitivity to Hypoxia-Activated Prodrugs.
26123203 2015 Functional POR A503V is associated with the risk of bladder cancer in a Chinese population.
26087061 2015 Analysis of the complex formation, interaction and electron transfer pathway between the "open" conformation of NADPH-cytochrome P450 reductase and aromatase.
26067485 2015 Multigene predictors of tacrolimus exposure in kidney transplant recipients.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25809265 2015 A well-balanced preexisting equilibrium governs electron flux efficiency of a multidomain diflavin reductase.
25728647 2015 Electron transfer by human wild-type and A287P mutant P450 oxidoreductase assessed by transient kinetics: functional basis of P450 oxidoreductase deficiency.
25712184 2015 Genetic variations in NADPH-CYP450 oxidoreductase in a Czech Slavic cohort.
25521355 2014 POR*28 SNP is associated with lipid response to atorvastatin in children and adolescents with familial hypercholesterolemia.
25495409 2014 Effects of major transporter and metabolizing enzyme gene polymorphisms on carbamazepine metabolism in Chinese patients with epilepsy.
25322286 2014 Combined effects of CYP3A5*1, POR*28, and CYP3A4*22 single nucleotide polymorphisms on early concentration-controlled tacrolimus exposure in de-novo renal recipients.
25288136 2015 Genome-wide meta-analysis identifies six novel loci associated with habitual coffee consumption.
25196843 2014 Protein/protein interactions in the mammalian heme degradation pathway: heme oxygenase-2, cytochrome P450 reductase, and biliverdin reductase.
24642534 2014 NADPH-cytochrome P450 reductase is regulated by all-trans retinoic acid and by 1,25-dihydroxyvitamin D3 in human acute myeloid leukemia cells.
24589657 2014 Proximal FAD histidine residue influences interflavin electron transfer in cytochrome P450 reductase and methionine synthase reductase.
24491563 2014 A cellular stress response (CSR) that interacts with NADPH-P450 reductase (NPR) is a new regulator of hypoxic response.
24465960 2014 Impact of the CYP3A5, CYP3A4, COMT, IL-10 and POR genetic polymorphisms on tacrolimus metabolism in Chinese renal transplant recipients.
24464600 2014 CYP2C9*2 allele increases risk for hypoglycemia in POR*1/*1 type 2 diabetic patients treated with sulfonylureas.
24448396 2014 Variation in P450 oxidoreductase (POR) A503V and flavin-containing monooxygenase (FMO)-3 E158K is associated with minor alterations in nicotine metabolism, but does not alter cigarette consumption.
24430948 2014 Lack of association of the p450 oxidoreductase *28 single nucleotide polymorphism with the lipid-lowering effect of statins in hypercholesterolemic patients.
24345815 2014 Effects of CYP2C19 and P450 oxidoreductase polymorphisms on the population pharmacokinetics of clobazam and N-desmethylclobazam in japanese patients with epilepsy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24196959 2013 Zinc finger nuclease knock-out of NADPH:cytochrome P450 oxidoreductase (POR) in human tumor cell lines demonstrates that hypoxia-activated prodrugs differ in POR dependence.
24113216 2013 Single-nucleotide polymorphisms in P450 oxidoreductase and peroxisome proliferator-activated receptor-? are associated with the development of new-onset diabetes after transplantation in kidney transplant recipients treated with tacrolimus.
23911089 2013 Redox-linked domain movements in the catalytic cycle of cytochrome p450 reductase.
23832577 2013 Molecular dynamics simulations give insight into the conformational change, complex formation, and electron transfer pathway for cytochrome P450 reductase.
23353702 2013 NADPH P450 oxidoreductase: structure, function, and pathology of diseases.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22547083 2012 Effect of P450 oxidoreductase variants on the metabolism of model substrates mediated by CYP2C9.1, CYP2C9.2, and CYP2C9.3.
22545110 2012 Heme oxygenase isoforms differ in their subcellular trafficking during hypoxia and are differentially modulated by cytochrome P450 reductase.
22462747 2012 Identification of six novel P450 oxidoreductase missense variants in Ashkenazi and Moroccan Jewish populations.
22177374 2011 Effects of the CYP oxidoreductase Ala503Val polymorphism on CYP3A activity in vivo: a randomized, open-label, crossover study in healthy Chinese men.
22162478 2012 Genotype-phenotype analysis in congenital adrenal hyperplasia due to P450 oxidoreductase deficiency.
21973081 2011 Effects of transient overexpression or knockdown of cytochrome P450 reductase on reactive oxygen species generation and hypoxia reoxygenation injury in liver cells.
21900384 2011 Proximal promoter of the cytochrome P450 oxidoreductase gene: identification of microdeletions involving the untranslated exon 1 and critical function of the SP1 binding sites.
21843508 2011 Deletion of P399_E401 in NADPH cytochrome P450 oxidoreductase results in partial mixed oxidase deficiency.
21808038 2011 Structural basis for human NADPH-cytochrome P450 oxidoreductase deficiency.
21770725 2011 The P450 oxidoreductase *28 SNP is associated with low initial tacrolimus exposure and increased dose requirements in CYP3A5-expressing renal recipients.
21762695 2012 Gating mechanisms for biological electron transfer: integrating structure with biophysics reveals the nature of redox control in cytochrome P450 reductase and copper-dependent nitrite reductase.
21741353 2011 Mutations of human cytochrome P450 reductase differentially modulate heme oxygenase-1 activity and oligomerization.
21726529 2011 Regulation of gap junction function and Connexin 43 expression by cytochrome P450 oxidoreductase (CYPOR).
21655236 2011 Biochemical comparison of Anopheles gambiae and human NADPH P450 reductases reveals different 2'-5'-ADP and FMN binding traits.
21393444 2011 Transcriptional regulation of the human P450 oxidoreductase gene: hormonal regulation and influence of promoter polymorphisms.
21269460 2011 Initial characterization of the human central proteome.
21265736 2011 Role of the interface between the FMN and FAD domains in the control of redox potential and electronic transfer of NADPH-cytochrome P450 reductase.
21164260 2011 Clinical and biochemical consequences of p450 oxidoreductase deficiency.
21084761 2011 Genetic polymorphisms and haplotypes of por, encoding cytochrome p450 oxidoreductase, in a Japanese population.
21081644 2011 Progesterone receptor membrane component 1 inhibits the activity of drug-metabolizing cytochromes P450 and binds to cytochrome P450 reductase.
21070833 2011 Consequences of POR mutations and polymorphisms.
20940534 2010 Effects of genetic variants of human P450 oxidoreductase on catalysis by CYP2D6 in vitro.
20879989 2010 Kinetics of electron transfer between NADPH-cytochrome P450 reductase and cytochrome P450 3A4.
20849814 2010 Reduction in hepatic drug metabolizing CYP3A4 activities caused by P450 oxidoreductase mutations identified in patients with disordered steroid metabolism.
20844025 2010 Impaired hepatic drug and steroid metabolism in congenital adrenal hyperplasia due to P450 oxidoreductase deficiency.
20732302 2010 Altered heme catabolism by heme oxygenase-1 caused by mutations in human NADPH cytochrome P450 reductase.
20722625 2010 Co-expression of recombinant human CYP2C9 with human cytochrome P450 reductase in protease deficient S. cerevisiae strain at a higher scale yields an enzyme of higher specific activity.
20697309 2010 Substrate-specific modulation of CYP3A4 activity by genetic variants of cytochrome P450 oxidoreductase.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20096935 2010 Cross-linking of human cytochrome P450 2B6 to NADPH-cytochrome P450 reductase: Identification of a potential site of interaction.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19884324 2010 Human cytochrome P450 oxidoreductase deficiency caused by the Y181D mutation: molecular consequences and rescue of defect.
19858215 2009 Domain motion in cytochrome P450 reductase: conformational equilibria revealed by NMR and small-angle x-ray scattering.
19837910 2009 Clinical, genetic, and enzymatic characterization of P450 oxidoreductase deficiency in four patients.
19805543 2009 Organization of cytochrome P450 enzymes involved in sex steroid synthesis: PROTEIN-PROTEIN INTERACTIONS IN LIPID MEMBRANES.
19744540 2009 Modeling of human P450 oxidoreductase structure by in silico mutagenesis and MD simulation.
19598235 2009 Genes related to sex steroids, neural growth, and social-emotional behavior are associated with autistic traits, empathy, and Asperger syndrome.
19483672 2009 Structure of the open conformation of a functional chimeric NADPH cytochrome P450 reductase.
19448135 2009 CYP2D6-CYP2C9 protein-protein interactions and isoform-selective effects on substrate binding and catalysis.
19374516 2009 Pharmacogenomics of human liver cytochrome P450 oxidoreductase: multifactorial analysis and impact on microsomal drug oxidation.
19258400 2009 Cytochrome P450 oxidoreductase deficiency: identification and characterization of biallelic mutations and genotype-phenotype correlations in 35 Japanese patients.
19161969 2009 Combined use of mass spectrometry and heterologous expression for identification of membrane-interacting peptides in cytochrome P450 46A1 and NADPH-cytochrome P450 oxidoreductase.
18681889 2008 Inter-flavin electron transfer in cytochrome P450 reductase - effects of solvent and pH identify hidden complexity in mechanism.
18630181 2008 [Antley-Bixler syndrome or POR deficiency?].
18559916 2008 Homozygous mutation G539R in the gene for P450 oxidoreductase in a family previously diagnosed as having 17,20-lyase deficiency.
18551037 2008 Pharmacogenetics of P450 oxidoreductase: effect of sequence variants on activities of CYP1A2 and CYP2C19.
18397975 2008 The common P450 oxidoreductase variant A503V is not a modifier gene for 21-hydroxylase deficiency.
18259105 2008 Genetic and clinical features of p450 oxidoreductase deficiency.
18230729 2008 Genetics of P450 oxidoreductase: sequence variation in 842 individuals of four ethnicities and activities of 15 missense mutations.
18216718 2008 Genetic polymorphisms in cytochrome P450 oxidoreductase influence microsomal P450-catalyzed drug metabolism.
17881660 2007 Cyclic conversion of the novel Src kinase inhibitor [7-(2,6-dichloro-phenyl)-5-methyl-benzo[1,2,4]triazin-3-yl]-[4-(2-pyrrolidin-1-yl-ethoxy)-phenyl]-amine (TG100435) and Its N-oxide metabolite by flavin-containing monoxygenases and cytochrome P450 reductase.
17827787 2007 Novel SNPs in cytochrome P450 oxidoreductase.
17635179 2007 Clinical, structural and functional implications of mutations and polymorphisms in human NADPH P450 oxidoreductase.
17595315 2007 Modulation of human CYP19A1 activity by mutant NADPH P450 oxidoreductase.
17580970 2007 Conformational dynamics and the energetics of protein--ligand interactions: role of interdomain loop in human cytochrome P450 reductase.
17505056 2007 Differential inhibition of CYP17A1 and CYP21A2 activities by the P450 oxidoreductase mutant A287P.
17440066 2007 A variant in the cytochrome p450 oxidoreductase gene is associated with breast cancer risk in African Americans.
17018578 2007 Motexafin gadolinium-induced cell death correlates with heme oxygenase-1 expression and inhibition of P450 reductase-dependent activities.
16998238 2006 Diminished FAD binding in the Y459H and V492E Antley-Bixler syndrome mutants of human cytochrome P450 reductase.
16574318 2007 Bioreductive activation of mitoxantrone by NADPH cytochrome P450 reductase. Implications for increasing its ability to inhibit the growth of sensitive and multidrug resistant leukaemia HL60 cells.
16520232 2006 Human cytochrome P450 reductase can act as a source of endogenous oxidative DNA damage and genetic instability.
16467261 2005 P450 oxidoreductase deficiency: a new disorder of steroidogenesis.
16445284 2006 Global effects of the energetics of coenzyme binding: NADPH controls the protein interaction properties of human cytochrome P450 reductase.
16434211 2006 Establishment of a yeast system that stably expresses human cytochrome P450 reductase: application for the study of drug metabolism of cytochrome P450s in vitro.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15793702 2005 Diversity and function of mutations in p450 oxidoreductase in patients with Antley-Bixler syndrome and disordered steroidogenesis.
15666840 2004 P450 oxidoreductase deficiency: a new disorder of steroidogenesis affecting all microsomal P450 enzymes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15483095 2005 Cytochrome P450 oxidoreductase gene mutations and Antley-Bixler syndrome with abnormal genitalia and/or impaired steroidogenesis: molecular and clinical studies in 10 patients.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15264278 2004 Compound heterozygous mutations of cytochrome P450 oxidoreductase gene (POR) in two patients with Antley-Bixler syndrome.
15220035 2004 Congenital adrenal hyperplasia caused by mutant P450 oxidoreductase and human androgen synthesis: analytical study.
14999778 2004 Immunohistochemical analysis of NAD(P)H:quinone oxidoreductase and NADPH cytochrome P450 reductase in human superficial bladder tumours: relationship between tumour enzymology and clinical outcome following intravesical mitomycin C therapy.
14758361 2004 Mutant P450 oxidoreductase causes disordered steroidogenesis with and without Antley-Bixler syndrome.
12901793 2003 Distinct mechanisms of site-specific oxidative DNA damage by doxorubicin in the presence of copper(II) and NADPH-cytochrome P450 reductase.
12853948 2003 The DNA sequence of human chromosome 7.
12787027 2003 Interflavin electron transfer in human cytochrome P450 reductase is enhanced by coenzyme binding. Relaxation kinetic studies with coenzyme analogues.
12782579 2003 Human enzymes involved in the metabolic activation of the environmental contaminant 3-nitrobenzanthrone: evidence for reductive activation by human NADPH:cytochrome p450 reductase.
12725870 2003 Organization of multiple cytochrome P450s with NADPH-cytochrome P450 reductase in membranes.
12688675 2003 Differential ability of cytostatics from anthraquinone group to generate free radicals in three enzymatic systems: NADH dehydrogenase, NADPH cytochrome P450 reductase, and xanthine oxidase.
12626517 2003 The binding sites on human heme oxygenase-1 for cytochrome p450 reductase and biliverdin reductase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11971899 2002 NADPH-cytochrome P-450 reductase in the plasma membrane modulates the activation of hypoxia-inducible factor 1.
11926825 2002 Relaxation kinetics of cytochrome P450 reductase: internal electron transfer is limited by conformational change and regulated by coenzyme binding.
11716457 2001 Expression, purification, and biochemical characterization of a human cytochrome P450 CYP2D6-NADPH cytochrome P450 reductase fusion protein.
11350900 2001 Expression of DT-diaphorase and cytochrome P450 reductase correlates with mitomycin C activity in human bladder tumors.
11329263 2001 Stopped-flow kinetic studies of flavin reduction in human cytochrome P450 reductase and its component domains.
11329262 2001 Determination of the redox properties of human NADPH-cytochrome P450 reductase.
11181502 2001 Variables in human liver microsome preparation: impact on the kinetics of l-alpha-acetylmethadol (LAAM) n-demethylation and dextromethorphan O-demethylation.
11123926 2000 Trp-676 facilitates nicotinamide coenzyme exchange in the reductive half-reaction of human cytochrome P450 reductase: properties of the soluble W676H and W676A mutant reductases.
11118675 2000 Cytochrome P450 reductase-mediated anaerobic biotransformation of ethanol to 1-hydroxyethyl-free radicals and acetaldehyde.
11035953 2000 Roles of NADPH-P450 reductase in the O-deethylation of 7-ethoxycoumarin by recombinant human cytochrome P450 1B1 variants in Escherichia coli.
10990198 2000 Creation of polarized cells coexpressing CYP3A4, NADPH cytochrome P450 reductase and MDR1/P-glycoprotein.
10448278 1999 Carbonyl reductase and NADPH cytochrome P450 reductase activities in human tumoral versus normal tissues.
10048323 1999 Crystal structure of the FMN-binding domain of human cytochrome P450 reductase at 1.93 A resolution.
9888582 The molecular basis of isolated 17,20 lyase deficiency.
9847074 1998 Toward a complete human genome sequence.
9787138 1998 Abnormal microsomal detoxification implicated in Fanconi anemia group C by interaction of the FAC protein with NADPH cytochrome P450 reductase.
9642268 1998 Identification of the binding site on cytochrome P450 2B4 for cytochrome b5 and cytochrome P450 reductase.
9618440 1998 Metabolism of arachidonic acid to 20-hydroxy-5,8,11, 14-eicosatetraenoic acid by P450 enzymes in human liver: involvement of CYP4F2 and CYP4A11.
9398194 1997 Kinetics of ferric cytochrome P450 reduction by NADPH-cytochrome P450 reductase: rapid reduction in the absence of substrate and variations among cytochrome P450 systems.
9335117 1997 1H, 15N and 13C NMR resonance assignment, secondary structure and global fold of the FMN-binding domain of human cytochrome P450 reductase.
8812989 Crystallization and preliminary X-ray diffraction studies of human cytochrome P450 reductase.
8615895 1996 Generation of a free radical from calphostin C by microsomal cytochrome P450 reductase in rat and human liver.
8460938 1993 Purification of multiple forms of cytochrome P450 from a human brain and reconstitution of catalytic activities.
7703255 1995 Expression and characterization of truncated human heme oxygenase (hHO-1) and a fusion protein of hHO-1 with human cytochrome P450 reductase.
2516426 1989 Isolation of a human cytochrome P-450 reductase cDNA clone and localization of the corresponding gene to chromosome 7q11.2.
2513880 1989 Structural and functional analysis of NADPH-cytochrome P-450 reductase from human liver: complete sequence of human enzyme and NADPH-binding sites.
1550342 1992 Quantification of cytochrome P450 reductase gene expression in human tissues.