Property Summary

NCBI Gene PubMed Count 6
PubMed Score 5.44
PubTator Score 1.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6514 2.3e-53
inflammatory breast cancer 272 1.3e-04
colon cancer 1428 1.7e-04

Expression

  Differential Expression (3)

Disease log2 FC p
colon cancer -1.500 1.7e-04
inflammatory breast cancer -1.300 1.3e-04
psoriasis -1.400 2.3e-53

AA Sequence

MSANSSRVGQLLLQGSACIRWKQDVEGAVYHLANCLLLLGFMGGSGVYGCFYLFGFLSAGYLCCVLWGWF      1 - 70
SACGLDIVLWSFLLAVVCLLQLAHLVYRLREDTLPEEFDLLYKTLCLPLQVPLQTYKEIVHCCEEQVLTL     71 - 140
ATEQTYAVEGETPINRLSLLLSGRVRVSQDGQFLHYIFPYQFMDSPEWESLQPSEEGVFQVTLTAETSCS    141 - 210
YISWPRKSLHLLLTKERYISCLFSALLGYDISEKLYTLNDKLFAKFGLRFDIRLPSLYHVLGPTAADAGP    211 - 280
ESEKGDEEVCEPAVSPPQATPTSLQQTPPCSTPPATTNFPAPPTRARLSRPDSGILASRIPLQSYSQVIS    281 - 350
RGQAPLAPTHTPEL                                                            351 - 364
//

Text Mined References (6)

PMID Year Title