Property Summary

NCBI Gene PubMed Count 14
PubMed Score 14.58
PubTator Score 12.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
tuberculosis 2010 4.8e-06
ovarian cancer 8520 4.1e-05
osteosarcoma 7950 5.3e-04
glioblastoma 5792 8.6e-04
group 3 medulloblastoma 4104 1.3e-03
lung cancer 4740 2.7e-03

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma 1.300 8.6e-04
group 3 medulloblastoma 1.200 1.3e-03
lung cancer 1.600 2.7e-03
osteosarcoma -1.403 5.3e-04
ovarian cancer 1.800 4.1e-05
tuberculosis 1.400 4.8e-06

 GO Function (1)

Gene RIF (3)

AA Sequence

MVRFKHRYLLCELVSDDPRCRLSLDDRVLSSLVRDTIARVHGTFGAAACSIGFAVRYLNAYTGIVLLRCR      1 - 70
KEFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRRQLLILLQNCTDEGEREAIQK     71 - 140
SVTRSCLLEEEEESGEEAAEAME                                                   141 - 163
//

Text Mined References (21)

PMID Year Title