Property Summary

NCBI Gene PubMed Count 13
PubMed Score 13.33
PubTator Score 12.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
tuberculosis 1563 4.8e-06
ovarian cancer 8491 4.1e-05
osteosarcoma 7933 5.3e-04
glioblastoma 5572 8.6e-04
group 3 medulloblastoma 2254 1.3e-03
lung cancer 4473 2.7e-03

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.403 5.3e-04
glioblastoma 1.300 8.6e-04
tuberculosis 1.400 4.8e-06
lung cancer 1.600 2.7e-03
group 3 medulloblastoma 1.200 1.3e-03
ovarian cancer 1.800 4.1e-05

Synonym

Accession Q969H6 A6NL80 Q53FS5 Q9Y2Q6 hPop5
Symbols RPP2
RPP20
hPop5
HSPC004

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
25704799 archaeal homologs of the human RNase P proteins Pop5 and Rpp30
22082156 Knockdown of processing of precursor 5, ribonuclease P/MRP subunit (S. cerevisiae; POP5) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
18164267 Molecular mechanism by which Cartilage-hair hypolasia-associated mutations affect the function of RNase MRP.

AA Sequence

MVRFKHRYLLCELVSDDPRCRLSLDDRVLSSLVRDTIARVHGTFGAAACSIGFAVRYLNAYTGIVLLRCR      1 - 70
KEFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRRQLLILLQNCTDEGEREAIQK     71 - 140
SVTRSCLLEEEEESGEEAAEAME                                                   141 - 163
//

Text Mined References (20)

PMID Year Title
25704799 2015 On archaeal homologs of the human RNase P proteins Pop5 and Rpp30 in the hyperthermophilic archaeon Thermococcus kodakarensis.
25416956 2014 A proteome-scale map of the human interactome network.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18164267 2008 Cartilage-hair hypoplasia-associated mutations in the RNase MRP P3 domain affect RNA folding and ribonucleoprotein assembly.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15096576 2004 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11413139 2001 hPop5, a protein subunit of the human RNase MRP and RNase P endoribonucleases.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10352175 1999 hPop4: a new protein subunit of the human RNase MRP and RNase P ribonucleoprotein complexes.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.