Property Summary

NCBI Gene PubMed Count 13
PubMed Score 40.58
PubTator Score 31.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
ovarian neoplasm 97
Disease Target Count P-value
ovarian cancer 8491 5.9e-05
Multiple myeloma 1327 4.9e-04
oligodendroglioma 2849 4.6e-02

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.326 4.9e-04
oligodendroglioma -1.200 4.6e-02
ovarian cancer 2.000 5.9e-05

AA Sequence

MKSVIYHALSQKEANDSDVQPSGAQRAEAFVRAFLKRSTPRMSPQAREDQLQRKAVVLEYFTRHKRKEKK      1 - 70
KKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCSGLKPDTQPQMIQAKLLKADLHGAII     71 - 140
SVTKSKCPSYVGITGILLQETKHIFKIITKEDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAK    141 - 210
KFKAKGTIDL                                                                211 - 220
//

Text Mined References (17)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16723659 2006 Differential association of protein subunits with the human RNase MRP and RNase P complexes.
16155184 2005 RNase P: role of distinct protein cofactors in tRNA substrate recognition and RNA-based catalysis.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15351636 2004 Inhibition of the expression of the human RNase P protein subunits Rpp21, Rpp25, Rpp29 by external guide sequences (EGSs) and siRNA.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15096576 2004 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14580343 2003 Eukaryotic RNase P: role of RNA and protein subunits of a primordial catalytic ribonucleoprotein in RNA-based catalysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11455963 2001 Protein-RNA interactions in the subunits of human nuclear RNase P.
10352175 1999 hPop4: a new protein subunit of the human RNase MRP and RNase P ribonucleoprotein complexes.
10024167 1999 Rpp14 and Rpp29, two protein subunits of human ribonuclease P.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.