Property Summary

NCBI Gene PubMed Count 24
PubMed Score 0.00
PubTator Score 29.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
group 3 medulloblastoma 2254 3.2e-05
medulloblastoma, large-cell 6234 9.2e-05
lung cancer 4473 1.0e-03
Breast cancer 3098 1.2e-03
osteosarcoma 7933 2.4e-03
colon cancer 1475 7.1e-03
Disease Target Count
Anauxetic dysplasia 2

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.303 2.4e-03
group 3 medulloblastoma 1.700 3.2e-05
medulloblastoma, large-cell 1.100 9.2e-05
colon cancer 1.500 7.1e-03
lung cancer 1.600 1.0e-03
Breast cancer 1.300 1.2e-03

Gene RIF (7)

PMID Text
26275995 by inhibiting inflammasome assembly, provides a regulatory feedback loop that shuts down excessive inflammatory responses; Cryopyrin-Associated Periodic Syndrome patients exhibit reduced expression
25839653 S-palmitoylation alters conformation or secondary structure of Trx1, as well as decreases the ability of Trx1 to transfer electrons from thioredoxin reductase to S-nitrosylated protein-tyrosine phosphatase 1B and S-nitroso-glutathione
22991464 Mitochondrial ribonuclease P structure provides insight into the evolution of catalytic strategies for precursor-trna 5' processing.
21509594 POP1 gene expression is increased in classic variant of papillary thyroid carcinoma.
21053045 Data idenified two cleavage sites for RNase MRP/RNase P in the coding sequence of viperin mRNA.
20453000 Observational study of gene-disease association. (HuGE Navigator)
16723659 A transient association of protein subunits may be inversely correlated to its involvement in pre-rRNA processing.

AA Sequence

MSNAKERKHAKKMRNQPTNVTLSSGFVADRGVKHHSGGEKPFQAQKQEPHPGTSRQRQTRVNPHSLPDPE      1 - 70
VNEQSSSKGMFRKKGGWKAGPEGTSQEIPKYITASTFAQARAAEISAMLKAVTQKSSNSLVFQTLPRHMR     71 - 140
RRAMSHNVKRLPRRLQEIAQKEAEKAVHQKKEHSKNKCHKARRCHMNRTLEFNRRQKKNIWLETHIWHAK    141 - 210
RFHMVKKWGYCLGERPTVKSHRACYRAMTNRCLLQDLSYYCCLELKGKEEEILKALSGMCNIDTGLTFAA    211 - 280
VHCLSGKRQGSLVLYRVNKYPREMLGPVTFIWKSQRTPGDPSESRQLWIWLHPTLKQDILEEIKAACQCV    281 - 350
EPIKSAVCIADPLPTPSQEKSQTELPDEKIGKKRKRKDDGENAKPIKKIIGDGTRDPCLPYSWISPTTGI    351 - 420
IISDLTMEMNRFRLIGPLSHSILTEAIKAASVHTVGEDTEETPHRWWIETCKKPDSVSLHCRQEAIFELL    421 - 490
GGITSPAEIPAGTILGLTVGDPRINLPQKKSKALPNPEKCQDNEKVRQLLLEGVPVECTHSFIWNQDICK    491 - 560
SVTENKISDQDLNRMRSELLVPGSQLILGPHESKIPILLIQQPGKVTGEDRLGWGSGWDVLLPKGWGMAF    561 - 630
WIPFIYRGVRVGGLKESAVHSQYKRSPNVPGDFPDCPAGMLFAEEQAKNLLEKYKRRPPAKRPNYVKLGT    631 - 700
LAPFCCPWEQLTQDWESRVQAYEEPSVASSPNGKESDLRRSEVPCAPMPKKTHQPSDEVGTSIEHPREAE    701 - 770
EVMDAGCQESAGPERITDQEASENHVAATGSHLCVLRSRKLLKQLSAWCGPSSEDSRGGRRAPGRGQQGL    771 - 840
TREACLSILGHFPRALVWVSLSLLSKGSPEPHTMICVPAKEDFLQLHEDWHYCGPQESKHSDPFRSKILK    841 - 910
QKEKKKREKRQKPGRASSDGPAGEEPVAGQEALTLGLWSGPLPRVTLHCSRTLLGFVTQGDFSMAVGCGE    911 - 980
ALGFVSLTGLLDMLSSQPAAQRGLVLLRPPASLQYRFARIAIEV                              981 - 1024
//

Text Mined References (36)

PMID Year Title
26275995 2015 The PYRIN Domain-only Protein POP1 Inhibits Inflammasome Assembly and Ameliorates Inflammatory Disease.
25839653 2015 Crystal structure of human POP1 and its distinct structural feature for PYD domain.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22991464 2012 Mitochondrial ribonuclease P structure provides insight into the evolution of catalytic strategies for precursor-tRNA 5' processing.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22210626 2012 Genome-wide association study in multiple human prion diseases suggests genetic risk factors additional to PRNP.
21509594 2011 Differential expression of a set of genes in follicular and classic variants of papillary thyroid carcinoma.
21455487 2011 Whole-exome re-sequencing in a family quartet identifies POP1 mutations as the cause of a novel skeletal dysplasia.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21053045 2011 Viperin mRNA is a novel target for the human RNase MRP/RNase P endoribonuclease.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16723659 2006 Differential association of protein subunits with the human RNase MRP and RNase P complexes.
15635413 2005 Nucleolar proteome dynamics.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15096576 2004 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12483731 2002 Identity of the RNase MRP- and RNase P-associated Th/To autoantigen.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11694598 2001 Basic domains target protein subunits of the RNase MRP complex to the nucleolus independently of complex association.
11455963 2001 Protein-RNA interactions in the subunits of human nuclear RNase P.
10199568 1999 RNA-protein interactions in the human RNase MRP ribonucleoprotein complex.
9725903 1998 Partially processed pre-rRNA is preserved in association with processing components in nucleolus-derived foci during mitosis.
9405234 1997 A bidirectional promoter connects the p14.5 gene to the gene for RNase P and RNase MRP protein subunit hPOP1.
8918471 1996 hPop1: an autoantigenic protein subunit shared by the human RNase P and RNase MRP ribonucleoproteins.
7584044 1994 Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1.