Property Summary

NCBI Gene PubMed Count 178
PubMed Score 154.35
PubTator Score 176.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -1.100 3.6e-06
esophageal adenocarcinoma 1.100 2.2e-02
psoriasis 1.100 1.0e-05
osteosarcoma 1.629 8.1e-07
group 4 medulloblastoma -2.600 4.4e-07
medulloblastoma, large-cell -3.300 2.6e-07
tuberculosis and treatment for 3 months 1.200 1.6e-05
primary pancreatic ductal adenocarcinoma 1.272 4.8e-03
intraductal papillary-mucinous carcinoma... 1.500 6.8e-03
intraductal papillary-mucinous neoplasm ... 1.500 2.2e-02
lung cancer 2.300 3.7e-03
pancreatic cancer 1.400 9.8e-03
lung adenocarcinoma 1.324 4.6e-04
Pick disease 1.100 5.8e-04
ovarian cancer 2.600 1.3e-05
Down syndrome 1.800 4.2e-04

Gene RIF (195)

PMID Text
26656916 Data indicate the relationship between ubiqutination of lysine (Lys) 168 and paraoxonase 2 (PON2) catalytic activity.
26227792 PON2 SNPs rs12026 and rs7493 were associated with intracerebral hemorrhage. The C alleles of rs12026 and rs7493 contributed to a decreased risk of ICH.
26056385 PON2 is a central regulator of host cell responses to Pseudomonas aeruginosa N-(3-oxo-dodecanoyl)-L-homoserine lactone
25991559 Haplotype containing two risk alleles of PON1 and PON2 genes was significantly associated with disease diabetes mellitus, type 2.
25953737 Data suggest cigarette smoke leads to inhibition of hydrolytic activity of paraoxonase isoenzymes (PON1, PON2, PON3) by modification of thiol groups, by interactions with free radicals/heavy metals, or by decreasing HDL level in blood. [REVIEW]
25913154 Newborns with PON2 148AG/GG genotype and exposed to high concentrations of MBP and MEHP had higher risks of LBW and SBL
25740199 D1-like receptors inhibit ROS production by altering PON2 distribution in membrane microdomains in the short-term, and by increasing PON2 expression in the long-term.
25708945 PON2 levels reflect the cells' irradiation sensitivity.
25210784 Taken together, our data suggest a model by which DJ-1 exerts its antioxidant activities, at least partly through regulation of PON2.
25038992 PON2 and PON3 (i) are associated with mitochondria and mitochondria-associated membranes, (ii) modulate mitochondria-dependent superoxide production, and (iii) prevent apoptosis.
24845160 Maternal genetic susceptibility GSTT1 and PON2 rs12026 could significantly modify the association of organic solvents with gestational age.
24816800 changes in PON2 in the placenta in labour
24807171 A modest dose-dependent allele effect between the PON2 c.311C > G polymorphism, increased triglyceride concentrations and decreased LDL particle size distribution.
24727057 S311C PON2 polymorphism is associated with the accelerated decline in kidney function in the chronic glomerulonephritis patients.
24636586 There were no statistically significant differences among all comparisons in pon2 mutation in patient with ischemic stroke.
24421402 Data indicate that paraoxonase 2 (PON2) is a transmembrane protein that localizes to the plasma membrane in small intestinal tissue.
24301778 We conclude that the PON1 55M and PON2 311C alleles are independent risk factors for CAAD in essential hypertension patients from the Xinjiang Han population.
24100645 The current metaanalysis highlighted results for the risk of association of PON155L with diabetic retinopathy (DR) and that PON2 gene polymorphisms, as well as PON1Q192R, may not confer major genetic risk to diabetic nephropathy or DR.
24088404 No significant differences were found for PON2-311 genotypes or allele frequencies in patients with dementia due to Alzheimer's disease.
23742759 Individuals homozygous for the R allele of the PON1 gene and the C allele of the PON2 gene are more likely to have an increased risk of coronary artery disease.
23487294 The polymorphisms of the PON genes studied are not related to increased risk of MS in the Polish population.
23327886 A case-control study of Chinese workers exposed to occupational noise, PON2 gene polymorphisms(rs7493, rs12026, rs7785846 and rs7786401)was associated with a higher risk to noise-induced hearing loss. No higher risk was found for genotype rs12704796.
23225229 hypertension, HDL-cholesterol concentration, and the presence of C allele in PON2 gene were independently associated with atherothrombotic events; study sheds light on role of PON2 as a possible cofactor in determining risk of events together with the well-known risk markers HDL-cholesterol and hypertension
23053877 In the presence of metabolic syndrome and diabetes, PON2-311CC was associated with an increased risk of significant coronary stenosis.
22964087 Data suggest that mRNA expression and activity of PON-2 enzyme in monocytes and macrophages can be modulated by dietary factors (here, traditional Brazilian beverages/tea made from green or roasted yerba mate).
22860094 lower PPARgamma and PON2 gene expression in the BALF of children with CF is associated specifically with P. aeruginosa infection and neutrophilia.
22744335 Paraoxonase (PON) family members seem central to a wide variety of human illnesses, but appreciation of their antioxidative function in the gastrointestinal tract is in its infancy
22534874 PON2 acts as a QS-quenching factor in keratinocytes and may have an important role in cutaneous defense against bacterial infections.
22190034 HIV-1 Rev interacting protein, paraoxonase 2 (PON2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with PON2 is increased by RRE
22183305 The aim of this study was to perform a meta-analysis to investigate a more authentic association between PON2 Ser311Cys polymorphism and ischemic stroke.
22174317 HIV-1 Rev interacting protein, paraoxonase 2 (PON2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with PON2 is increased by RRE
22016051 The association of PON2, with Parkinson's disease among Indians may point toward an inherent population-specific genetic predisposition
21765051 Single-nucleotide polymorphisms in PON2 is associated with chronic kidney disease in Type 2 diabetes.
21757906 the studied PON2 polymorphism is not associated with late-onset Alzheimer's disease
21672555 Both paraoxonases are expressed in the human frontal cortex; PON2 but not PON1 mRNA levels are up-regulated in Alzheimer disease.
21620813 polymorphisms of pon1 gene affect PON1 paraoxonase activity while S311C polymorphism of pon2 gene might be associated with coronary heart disease
21561808 Polymorphisms within Pon1, Pon2, and GSTM1 are associated with male infertility.
21368884 Deficiency of PON2 caused apoptosis of selective tumor cells.
21223581 PON2 genetic variation is significantly and independently associated with variation in serum PON activity and no obvious association between PON2 tagSNPs and SLE risk.
21146823 This meta-analysis suggested no association between the PON2 polymorphisms and coronary heart disease risk.
21127310 the PON1 55M and PON1 192R alleles were associated with decreased sperm motility whereas the PON2 311C allele was associated with decreased concentration, supporting the significance of PON genes in semen quality.
21118365 in hemodialysis patients, frequency distribution of PON ratio showed 3 PON phenotypes: 74% oshowed PON1, 21% PON2, and 5% PON3. Compared to hemodialysis patients with PON1, patients with PON2 or 3 showed higher conversion rates for 4-nitrophenylacetate
20980077 Low serum paraoxonase activity is a risk factor for Alzheimer disease; furthermore, multiple variants in PON influence serum paraoxonase activity and their effects may be synergistic.
20980077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20934178 paraoxonase components PON1, PON2, and PON3 are regulated by diverse nutritional molecules and pharmacological agents and pathophysiological events, such as oxidative stress and inflammation [review]
20839225 These functional effects of PON1, PON2, PON3 variation should be considered in protecting vulnerable subpopulations from organophosphate pesticides and other inducers of oxidative stress.
20839225 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20582942 We now report that in genomic DNA from individuals with familial and sporadic amyotrophic lateral sclerosis, we have identified at least 7 gene mutations that are predicted to alter PON1, PON2, and PON3 function.
20582942 Observational study of gene-disease association. (HuGE Navigator)
20565774 Observational study of genotype prevalence. (HuGE Navigator)
20536507 genetic variants, including Ala/Ala of SCYA11 (eotaxin) Ala23Thr, Cys/Cys or Cys/Ser of PON2 (paraoxonase 2) Ser311Cys and Arg/Arg of ADRB3 (beta3-adrenergic receptor) Trp64Arg, were independently associated with incident cardiac end-point.
20536507 Observational study of gene-disease association. (HuGE Navigator)
20530481 PON2 prevents mitochondrial superoxide formation and apoptosis independent from its lactonase activity
20529763 Observational study of gene-disease association. (HuGE Navigator)
20503442 differences between PON2 mRNA and protein distributions could be due to missence mutations in the PON2 gene, causing nontranslation of mRNA to protein in some tissues
20485444 Observational study of gene-disease association. (HuGE Navigator)
20458436 Observational study of gene-disease association. (HuGE Navigator)
20430392 Observational study of gene-disease association. (HuGE Navigator)
20381198 The data of this study suggested that PON2 polymorphisms are not involved in ALS pathogenesis in an Italian population.
20099504 Serum paraoxonase 1, arylesterase activities and total free sulphydryl group levels were significantly lower in endometrial cancer patients compared to controls
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19939821 Observational study of gene-disease association. (HuGE Navigator)
19930448 The PON2 311C allele is suggested as a possible predisposing factor for severe cases of ischemic stroke.
19930448 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19878569 Observational study of gene-disease association. (HuGE Navigator)
19865538 Quercetin supplementation increases PON2 levels in cultured monocytes in vitro but not in human volunteers in vivo.
19840942 impaired lactonase activity may play a role in innate immunity, atherosclerosis, and other diseases associated with the PON2 311 SNP.
19840942 Observational study of gene-disease association. (HuGE Navigator)
19818126 Observational study of gene-disease association. (HuGE Navigator)
19654933 the allele and genotype frequencies of PON polymorphisms were described in a south-western Korean population
19654933 Observational study of gene-disease association. (HuGE Navigator)
19587357 Meta-analysis of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19575027 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19546579 Observational study of gene-disease association. (HuGE Navigator)
19540141 a possible role for PON2 C311S polymorphism in the pathogenesis of cardiac ischemic damage
19540141 Observational study of gene-disease association. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19497963 Urokinase activates macrophage PON2 gene transcription via the PI3K/ROS/MEK/SREBP-2 signalling cascade mediated by the PDGFR-beta.
19479237 Observational study of gene-disease association. (HuGE Navigator)
19401157 Oxidative stress and proinflammatory agents selectively affect the expression of PONs.
19371607 Observational study of gene-disease association. (HuGE Navigator)
19263529 Observational study of gene-disease association. (HuGE Navigator)
19254215 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19166692 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19152805 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19151417 Observational study of gene-disease association. (HuGE Navigator)
19131662 Meta-analysis of gene-disease association. (HuGE Navigator)
19091699 Data suggest that PON2 attenuates macrophage triglyceride accumulation and foam cell formation via inhibition of microsomal DGAT1 activity, which appears to be sensitive to oxidative state.
19082953 The anti-atherogenic biological activities were studied in vitro using serum or cell cultures, and also in vivo, using PON 1/2/3 knockout or transgenic mice, as well as humans - healthy volunteers and atherosclerotic patients.
19019335 Observational study of gene-disease association. (HuGE Navigator)
18977341 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18776646 This study revealed a significant association between Ser311Cys variation in the paraoxonase 2 gene and type 2 diabetes in northern Chinese.
18759523 major effect of the paraoxonase-2 polymorphism on coronary artery disease risk in patients
18759523 Observational study of gene-disease association. (HuGE Navigator)
18720901 Observational study of genotype prevalence. (HuGE Navigator)
18695162 Observational study of gene-disease association. (HuGE Navigator)
18691157 Data suggest that independent mechanisms mediate the degradation of paraoxonase-2 mRNA and protein after disturbance of calcium homoeostasis.
18635682 Observational study of gene-disease association. (HuGE Navigator)
18569577 Observational study of gene-disease association. (HuGE Navigator)
18513389 Observational study of gene-disease association. (HuGE Navigator)
18436804 Urokinase plasminogen activator upregulates paraoxonase 2 expression in macrophages via an NADPH oxidase-dependent mechanism.
18427977 Observational study of genetic testing. (HuGE Navigator)
18413200 Observational study of gene-disease association. (HuGE Navigator)
18361900 results indicate that PON2-311 polymorphism is an independent risk factor of AMI
18361900 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18347034 The hydrolytic effects of PON1, PON2, and PON3 on the key quorum sensing compound of P.aeruginosa are reported.
18258817 We demonstrate that PON2 mRNA and protein are decreased in plaques versus plaque-adjacent tissue, mammary arteries, and fetal carotids. Our data indicate that the protective effect of PON2 could fail during atherosclerosis exacerbation.
18063859 There was no significant correlation between the C311S and G148A polymorphisms of PON2 and stroke in the Chinese population.
18063859 Observational study of gene-disease association. (HuGE Navigator)
18020951 PON2 expression is upregulated in unesterified cholesterol enriched macrophages through activation of the PI(3)K signal pathway
17940058 Cys(311)Ser variant of PON2 may contribute to albumin excretion rate
17916643 These observations demonstrate that the human intestine is preferentially endowed with a marked PON2 expression compared with the rat intestine and this expression shows a developmental and intracellular pattern of distribution.
17854416 Observational study of gene-disease association. (HuGE Navigator)
17664137 PON1/2/3 may have extracellular functions as part of the host response in inflammatory bowel diseases and celiac disease
17601350 Observational study of gene-disease association. (HuGE Navigator)
17557249 C311S polymorphism of PON2 has no significant correlation with stroke in Han people of Chinese Hunan area and allele C/S is not an independent risk factor for stroke,neither is G148A.
17557249 Observational study of gene-disease association. (HuGE Navigator)
17436100 Observational study of gene-disease association. (HuGE Navigator)
17436100 In Ashkenazi Jewish population, carriage of PON1 R192 allele may confer protection against the development of IBD.
17428620 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17412306 The rates of hydrolysis of estrogen esters by the paraoxonases is PON3 > PON1 > PON2, with the exception of 17beta estradiol, 3-acetate, 17-cyclopentylpropionate which is hydrolyzed at a slightly faster rate by PON2 compared to PON1.
17406108 Observational study of gene-disease association. (HuGE Navigator)
17406108 genotypes with the C allele of the PON2 gene C311S polymorphism is a risk factor for large vessel disease stroke in a Polish population
17404154 Here, we analyzed the ROS-reducing capability of paraoxonase-2 (PON2) in different vascular cells and its involvement in the endoplasmic reticulum stress pathway known as the unfolded protein response.
17309646 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17299970 Gene polymorphisms of PON1 55 Met/Leu, PON2 148 Ala/Gly and MnSOD 9 Ala/Val seemed to involve in the morbidity of CHD by influencing the plasma activities of PON and MnSOD.
17299970 Observational study of gene-disease association. (HuGE Navigator)
17137217 Observational study of gene-disease association. (HuGE Navigator)
17096118 Observational study of gene-disease association. (HuGE Navigator)
17096118 PON2 variants have, at best, a small effect on the risk of renal dysfunction in type 2 diabetes.
16926679 Observational study of gene-disease association. (HuGE Navigator)
16891303 Plays a protective role against atherosclerosis in vivo.
16822965 Observational study of gene-disease association. (HuGE Navigator)
16822965 the C311S polymorphism was associated with sALS in dominant and additive models.
16822964 Observational study of gene-disease association. (HuGE Navigator)
16822964 A haploblock of high linkage disequilibrium (LD) spanning PON2 and PON3 was associated with SALS.
16776623 Observational study of gene-disease association. (HuGE Navigator)
16767666 PON1 55 LM genotype and M allele, PON2 148 GG/AG genotype and G allele are the risk factors for coronary artery disease, and the activity of plasma PON is also markedly reduced in individuals with above genotypes.
16767666 Observational study of gene-disease association. (HuGE Navigator)
16614106 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16551349 Observational study of gene-disease association. (HuGE Navigator)
16411107 Observational study of gene-disease association. (HuGE Navigator)
16319130 Observational study of gene-disease association. (HuGE Navigator)
16185677 Observational study of genetic testing. (HuGE Navigator)
16164576 Observational study of gene-disease association. (HuGE Navigator)
16141008 Observational study of gene-disease association. (HuGE Navigator)
16135439 Observational study of gene-disease association. (HuGE Navigator)
16117861 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16080611 Observational study of gene-disease association. (HuGE Navigator)
16078734 Observational study of gene-disease association. (HuGE Navigator)
16030523 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15776585 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15772423 PON1, PON2, and PON3 are lactonases with overlapping and distinct substrate specificities
15544923 PON2 stimulation may represent a compensatory mechanism against the increase in cellular superoxide anion production and atherogenesis
15359538 Observational study of genotype prevalence. (HuGE Navigator)
15345661 Observational study of gene-disease association. (HuGE Navigator)
15256524 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15232408 Observational study of gene-disease association. (HuGE Navigator)
15232408 Genotyping for polymorphisms of PON1 Q192R, PON2 A148G, and PON2 S311C finds no association between mother's PON1 and PON2 genotypes and preterm delivery, but finds infant's PON1 RR and PON2 CC genotypes are associated with preterm delivery.
15039125 Observational study of gene-disease association. (HuGE Navigator)
15001326 Meta-analysis of gene-disease association. (HuGE Navigator)
14996478 Observational study of gene-disease association. (HuGE Navigator)
14984433 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14741412 Observational study of gene-disease association. (HuGE Navigator)
14741412 These results suggested that the PON2 polymorphism might be a risk factor for LOAD independent of ApoE epsilon4 status in Chinese.
14636952 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12955589 Observational study of gene-disease association. (HuGE Navigator)
12955589 Polymorphisms of paraoxonase 1 and 2 genes, alone or in combination is associated with with bone mineral density
12939804 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12778447 Observational study of gene-disease association. (HuGE Navigator)
12588779 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12561466 Observational study of gene-disease association. (HuGE Navigator)
12454802 Observational study of gene-disease association. (HuGE Navigator)
12454802 Association between the severity of angiographic coronary artery disease and paraoxonase gene polymorphisms in the National Heart, Lung, and Blood Institute-sponsored Women's Ischemia Syndrome Evaluation (WISE) study
12442067 Observational study of gene-disease association. (HuGE Navigator)
12433026 Observational study of gene-disease association. (HuGE Navigator)
12151850 REVIEW: The paraoxonase gene family and coronary heart disease
12082592 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
11918623 Observational study of gene-disease association. (HuGE Navigator)
11918623 diabetic microangiopathy is genetically heterogeneous; PON1 Leu/Leu increases the risk for retinopathy and PON2 Ser/Ser increases the risk for microalbuminuria
11803456 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11803456 PON2*S and apoE4 alleles have interactive effect on the development of the two most common forms of dementias AD and VD, and further support the hypothesis that cardiovascular factors contribute to the development of AD.
11768721 Observational study of gene-disease association. (HuGE Navigator)
11768721 association between left ventricular hypertrophy and the C825T allele of the G-protein beta3 subunit gene in Arabs. (G PROTEIN BETA3)
11692002 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11676977 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11676977 study suggested a gene-gene interaction between the PON1 and PON2 polymorphisms for CAD risk; may have linkage disequilibrium with a tightly linked PON3 locus or significant atherosclerotic alleles of nearby genes
11512679 Observational study of genotype prevalence. (HuGE Navigator)
11257265 Observational study of gene-disease association. (HuGE Navigator)
11206400 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVDLPHCHLIKGIEAGSEDIDILPNGLAFFSVGLK      1 - 70
FPGLHSFAPDKPGGILMMDLKEEKPRARELRISRGFDLASFNPHGISTFIDNDDTVYLFVVNHPEFKNTV     71 - 140
EIFKFEEAENSLLHLKTVKHELLPSVNDITAVGPAHFYATNDHYFSDPFLKYLETYLNLHWANVVYYSPN    141 - 210
EVKVVAEGFDSANGINISPDDKYIYVADILAHEIHVLEKHTNMNLTQLKVLELDTLVDNLSIDPSSGDIW    211 - 280
VGCHPNGQKLFVYDPNNPPSSEVLRIQNILCEKPTVTTVYANNGSVLQGSSVASVYDGKLLIGTLYHRAL    281 - 350
YCEL                                                                      351 - 354
//

Text Mined References (183)

PMID Year Title
26656916 2015 An Engineered Version of Human PON2 Opens the Way to Understand the Role of Its Post-Translational Modifications in Modulating Catalytic Activity.
26227792 2015 Association Between Paraoxonase Gene Polymorphisms and Intracerebral Hemorrhage in a Korean Population.
26056385 2015 Novel Paraoxonase 2-Dependent Mechanism Mediating the Biological Effects of the Pseudomonas aeruginosa Quorum-Sensing Molecule N-(3-Oxo-Dodecanoyl)-L-Homoserine Lactone.
25991559 2015 Oxidative stress-related genes in type 2 diabetes: association analysis and their clinical impact.
25953737 Paraoxonase activity as a marker of exposure to xenobiotics in tobacco smoke.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25913154 2015 Paraoxonase 2 gene polymorphisms and prenatal phthalates' exposure in Chinese newborns.
25740199 2015 Dopamine D1 and D5 receptors differentially regulate oxidative stress through paraoxonase 2 in kidney cells.
25708945 2015 Paraoxonase-2 (PON2) protects oral squamous cell cancer cells against irradiation-induced apoptosis.
25210784 2014 DJ-1 interacts with and regulates paraoxonase-2, an enzyme critical for neuronal survival in response to oxidative stress.
25038992 2014 Inflammation, infection, cancer and all that…the role of paraoxonases.
24845160 2014 Gene-environment interaction among GSTT1, PON2 polymorphisms and organic solvents on gestational age in a Chinese women cohort.
24816800 2014 Paraoxonase 2 protein is spatially expressed in the human placenta and selectively reduced in labour.
24807171 2014 Paraoxonase 2 sequence variation (c.311 C>G) is associated with a modest decrease in circulating LDL size in children and adolescents.
24727057 2014 Genes involved in the regulation of vascular homeostasis determine renal survival rate in patients with chronic glomerulonephritis.
24636586 2014 Response to letter to the editor: Paraoxonase genes and the susceptibility to ischemic stroke.
24421402 2014 Breaking the chain at the membrane: paraoxonase 2 counteracts lipid peroxidation at the plasma membrane.
24301778 2013 Association of paraoxonase polymorphisms with carotid artery atherosclerosis in essential hypertension patients.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24100645 2013 Association of paraoxonase gene polymorphisms with diabetic nephropathy and retinopathy.
24088404 2013 Study of lipids, insulin metabolism, and paraoxonase-2-311 polymorphism in patients with different subtypes of Alzheimer's disease (translated version).
23742759 2013 Associations between genetic polymorphisms of paraoxonase genes and coronary artery disease in a Taiwanese population.
23487294 Polymorphisms of paraoxonase 1 and 2 genes and the risk of multiple sclerosis in the Polish population.
23327886 2013 Association between paraoxonase 2 gene polymorphisms and noise-induced hearing loss in the Chinese population.
23225229 2013 Paraoxonase 1 L55M, Q192R and paraoxonase 2 S311C alleles in atherothrombosis.
23053877 2013 Association of PON1 and PON2 polymorphisms with PON1 activity and significant coronary stenosis in a Tunisian population.
22964087 Yerba mate (Ilex paraguariensis) enhances the gene modulation and activity of paraoxonase-2: in vitro and in vivo studies.
22860094 2012 Expression of PPAR? and paraoxonase 2 correlated with Pseudomonas aeruginosa infection in cystic fibrosis.
22744335 2012 Antioxidative properties of paraoxonase 2 in intestinal epithelial cells.
22534874 2012 Paraoxonase 2 acts as a quorum sensing-quenching factor in human keratinocytes.
22183305 2012 Association between paraoxonase 2 Ser311Cys polymorphism and ischemic stroke risk: a meta-analysis involving 5,008 subjects.
22016051 2011 Leads from xenobiotic metabolism genes for Parkinson's disease among north Indians.
21765051 2012 Predictive role of multilocus genetic polymorphisms in cardiovascular disease and inflammation-related genes on chronic kidney disease in Type 2 diabetes--an 8-year prospective cohort analysis of 1163 patients.
21757906 2011 Paraoxonase gene polymorphism and the risk for Alzheimer's disease in the polish population.
21672555 2011 Normalization of gene expression using SYBR green qPCR: a case for paraoxonase 1 and 2 in Alzheimer's disease brains.
21620813 2011 Polymorphisms of pon1 and pon2 genes in hemodialyzed patients.
21561808 2011 Association between male infertility and genetic variability at the PON1/2 and GSTM1/T1 gene loci.
21368884 2011 Beyond reduction of atherosclerosis: PON2 provides apoptosis resistance and stabilizes tumor cells.
21269460 2011 Initial characterization of the human central proteome.
21223581 2011 Association analysis of PON2 genetic variants with serum paraoxonase activity and systemic lupus erythematosus.
21146823 2011 Four genetic polymorphisms of paraoxonase gene and risk of coronary heart disease: a meta-analysis based on 88 case-control studies.
21127310 Association of paraoxonase gene polymorphisms with sperm parameters.
21118365 2010 Continuous reduction of plasma paraoxonase activity with increasing dialysis vintage in hemodialysis patients.
20980077 2012 Serum paraoxonase activity is associated with variants in the PON gene cluster and risk of Alzheimer disease.
20934178 2011 The three-gene paraoxonase family: physiologic roles, actions and regulation.
20839225 2011 Effects of PON polymorphisms and haplotypes on molecular phenotype in Mexican-American mothers and children.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20582942 2010 Paraoxonase gene mutations in amyotrophic lateral sclerosis.
20565774 2010 Population based allele frequencies of disease associated polymorphisms in the Personalized Medicine Research Project.
20536507 2010 Independent predictive roles of eotaxin Ala23Thr, paraoxonase 2 Ser311Cys and beta-adrenergic receptor Trp64Arg polymorphisms on cardiac disease in Type 2 Diabetes--an 8-year prospective cohort analysis of 1297 patients.
20530481 2010 One enzyme, two functions: PON2 prevents mitochondrial superoxide formation and apoptosis independent from its lactonase activity.
20529763 2010 Evaluation of candidate genes for cholinesterase activity in farmworkers exposed to organophosphorus pesticides: association of single nucleotide polymorphisms in BCHE.
20503442 2010 Human tissue distribution of paraoxonases 1 and 2 mRNA.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20458436 2010 Early-onset ischaemic stroke: analysis of 58 polymorphisms in 17 genes involved in methionine metabolism.
20430392 2010 No interaction between alcohol consumption and HDL-related genes on HDL cholesterol levels.
20381198 2011 Lack of association of PON polymorphisms with sporadic ALS in an Italian population.
20099504 2009 Assessment of serum paraoxonase and arylesterase activity in patients with endometrial cancer.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19939821 2010 The role of polymorphisms within paraoxonases (192 Gln/Arg in PON1 and 311Ser/Cys in PON2) in the modulation of cardiovascular risk: a pilot study.
19930448 2010 Paraoxonase gene polymorphisms and stroke severity.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19878569 2009 Candidate genetic analysis of plasma high-density lipoprotein-cholesterol and severity of coronary atherosclerosis.
19865538 2009 Effect of quercetin on paraoxonase 2 levels in RAW264.7 macrophages and in human monocytes--role of quercetin metabolism.
19840942 2009 A common mutation in paraoxonase-2 results in impaired lactonase activity.
19818126 2009 Single nucleotide polymorphisms in obesity-related genes and all-cause and cause-specific mortality: a prospective cohort study.
19654933 2009 Paraoxonase gene polymorphism in south-western Korean population.
19587357 2009 A systematic meta-analysis of genetic association studies for diabetic retinopathy.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19575027 2009 Genetic variation of genes for xenobiotic-metabolizing enzymes and risk of bronchial asthma: the importance of gene-gene and gene-environment interactions for disease susceptibility.
19546579 2009 Evaluation of polymorphisms in paraoxonase 2 (PON2) gene and their association with cardiovascular-renal disease risk in Mexican Americans.
19540141 2009 Paraoxonase2 C311S polymorphism and low levels of HDL contribute to a higher mortality risk after acute myocardial infarction in elderly patients.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19497963 2009 Urokinase activates macrophage PON2 gene transcription via the PI3K/ROS/MEK/SREBP-2 signalling cascade mediated by the PDGFR-beta.
19479237 2009 Phenotype-genotype interactions on renal function in type 2 diabetes: an analysis using structural equation modelling.
19401157 2009 Comparative expression analysis reveals differences in the regulation of intestinal paraoxonase family members.
19371607 2009 Risk of carotid atherosclerosis is associated with low serum paraoxonase (PON1) activity among arsenic exposed residents in Southwestern Taiwan.
19263529 2009 Genetic risk factors in recurrent venous thromboembolism: A multilocus, population-based, prospective approach.
19254215 2009 [Association of genetic factors with clinical peculiarities of hypertensive disease in patients with burdened familial anamnesis].
19166692 2009 Usefulness of genetic polymorphisms and conventional risk factors to predict coronary heart disease in patients with familial hypercholesterolemia.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19152805 2009 Synergistic effect of polymorphisms of paraoxonase gene cluster and arsenic exposure on electrocardiogram abnormality.
19151417 2009 Association of the novel cardiovascular risk factors paraoxonase 1 and cystatin C in type 2 diabetes.
19131662 2009 A meta-analysis of candidate gene polymorphisms and ischemic stroke in 6 study populations: association of lymphotoxin-alpha in nonhypertensive patients.
19091699 2009 Paraoxonase 2 attenuates macrophage triglyceride accumulation via inhibition of diacylglycerol acyltransferase 1.
19082953 2008 Paraoxonases (PON1, PON2, PON3) analyses in vitro and in vivo in relation to cardiovascular diseases.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18977341 2009 The measurement of the lactonase activity of paraoxonase-1 in the clinical evaluation of patients with chronic liver impairment.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18776646 2008 The Ser311Cys variation in the paraoxonase 2 gene increases the risk of type 2 diabetes in northern Chinese.
18759523 2008 Association of cys 311 ser polymorphism of paraoxonase-2 gene with the risk of coronary artery disease.
18720901 2008 Genetic profiling of genes from the oxidative stress pathway among North and South Indians.
18695162 2008 Association of paraoxonase gene cluster polymorphisms with ALS in France, Quebec, and Sweden.
18691157 2008 Protective effect of paraoxonase-2 against endoplasmic reticulum stress-induced apoptosis is lost upon disturbance of calcium homoeostasis.
18635682 2008 Genetic analysis of 56 polymorphisms in 17 genes involved in methionine metabolism in patients with abdominal aortic aneurysm.
18569577 2008 Sequence variations in subjects with self-reported multiple chemical sensitivity (sMCS): a case-control study.
18513389 2008 New application of intelligent agents in sporadic amyotrophic lateral sclerosis identifies unexpected specific genetic background.
18436804 2008 Urokinase plasminogen activator upregulates paraoxonase 2 expression in macrophages via an NADPH oxidase-dependent mechanism.
18427977 2008 High-throughput multiplex single-nucleotide polymorphism (SNP) analysis in genes involved in methionine metabolism.
18413200 Oxidative stress pathway genes and chronic renal insufficiency in Asian Indians with Type 2 diabetes.
18361900 2008 [Association between paraoxonase-1 and paraoxonase-2 polymorphisms and the risk of acute myocardial infarction].
18347034 2008 Dominant role of paraoxonases in inactivation of the Pseudomonas aeruginosa quorum-sensing signal N-(3-oxododecanoyl)-L-homoserine lactone.
18258817 2008 Decreased paraoxonase-2 expression in human carotids during the progression of atherosclerosis.
18063859 2008 Study of the relationship between gene polymorphisms of paraoxonase 2 and stroke in a Chinese population.
18020951 2007 Macrophage paraoxonase 2 (PON2) expression is upregulated by unesterified cholesterol through activation of the phosphatidylinositol 3-kinase (PI3K) pathway.
17940058 2008 The Cys(311)Ser polymorphism of paraoxonase 2 (PON2) is associated with albumin-to-creatinine ratio (ACR) in Mexican Americans.
17916643 2007 Biological role, protein expression, subcellular localization, and oxidative stress response of paraoxonase 2 in the intestine of humans and rats.
17854416 2008 The paraoxonase gene polymorphism in stroke patients and lipid profile.
17664137 2007 Paraoxonases are associated with intestinal inflammatory diseases and intracellularly localized to the endoplasmic reticulum.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17557249 2007 [Relationship between single nucleotide polymorphisms of paraoxonase 2 and stroke].
17436100 2007 Paraoxonase (PON)1 192R allele carriage is associated with reduced risk of inflammatory bowel disease.
17428620 2007 Body mass, polymorphisms in obesity-related genes, and the risk of developing breast cancer among women with benign breast disease.
17412306 2007 Estrogen esters as substrates for human paraoxonases.
17406108 2007 Paraoxonase 2 gene C311S polymorphism is associated with a risk of large vessel disease stroke in a Polish population.
17404154 2007 Paraoxonase-2 reduces oxidative stress in vascular cells and decreases endoplasmic reticulum stress-induced caspase activation.
17309646 2007 Interactions and associations of paraoxonase gene cluster polymorphisms with myocardial infarction in a Pakistani population.
17299970 2006 [Study of the association between paraoxonase1 55 Met/Leu, paraoxonase2 148 Ala/Gly and manganese superoxide dismutase (MnSOD) 9 Ala/Val genetic polymorphisms and coronary heart disease].
17137217 2006 Association of sixty-one non-synonymous polymorphisms in forty-one hypertension candidate genes with blood pressure variation and hypertension.
17096118 2006 Paraoxonase 2 (PON2) polymorphisms and development of renal dysfunction in type 2 diabetes: UKPDS 76.
16926679 2006 Paraoxonase genotype and carotid intima-media thickness in children with familial hypercholesterolemia.
16891303 2006 Paraoxonase-2 deficiency aggravates atherosclerosis in mice despite lower apolipoprotein-B-containing lipoproteins: anti-atherogenic role for paraoxonase-2.
16822965 2006 Paraoxonase gene polymorphisms and sporadic ALS.
16822964 2006 Paraoxonase cluster polymorphisms are associated with sporadic ALS.
16776623 2006 Polymorphisms associated with apolipoprotein B levels in Greek patients with familial hypercholesterolemia.
16767666 2006 [Relationship between paraoxonase 1 55 Met/Leu, paraoxonase 2 148 Ala/Gly genetic polymorphisms and coronary artery disease].
16614106 2006 GSTP1 genetic polymorphism is associated with a higher risk of DNA damage in pesticide-exposed fruit growers.
16551349 2006 Paraoxonase gene polymorphisms and haplotype analysis in a stroke population.
16411107 2006 Paraoxonase 1 gene polymorphisms influence clinical features of open-angle glaucoma.
16319130 2006 Polymorphisms in the PON gene cluster are associated with Alzheimer disease.
16185677 2006 Detecting the polymorphisms of paraoxonase (PON) cluster in Chinese Han population based on a rapid method.
16164576 2005 The paraoxonase-2-310 polymorphism is associated with the presence of microvascular complications in diabetes mellitus.
16141008 2005 Association of genes of lipid metabolism with measures of subclinical cardiovascular disease in the Diabetes Heart Study.
16135439 2002 [Association of PON2 gene polymorphisms in neonates with preterm].
16117861 2005 Paraoxonase gene cluster variations associated with coronary heart disease in Chinese Han women.
16080611 2005 [A search for association between the polymorphic markers of PON1 and PON2 genes and diabetic nephropathy in patients with type I diabetes mellitus].
16078734 2005 [Association analysis between polymorphisms of PON gene cluster with coronary heart disease in Chinese].
16030523 2005 Genetic determinants of plasma HDL-cholesterol levels in familial hypercholesterolemia.
15776585 2002 [Genetic polymorphism of pyruvate dehydrogenase kinase 4 (PDK4), paraoxonase 2 (PON2), and fatty acid binding protein 2 (FABP2) in the NIDDM population of Senegal].
15772423 2005 Human paraoxonases (PON1, PON2, and PON3) are lactonases with overlapping and distinct substrate specificities.
15607899 2005 The paraoxonase gene family and atherosclerosis.
15544923 2004 Paraoxonase 2 (PON2) expression is upregulated via a reduced-nicotinamide-adenine-dinucleotide-phosphate (NADPH)-oxidase-dependent mechanism during monocytes differentiation into macrophages.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15359538 2004 Genetic variants of the paraoxonases (PON1 and PON2) in the Chilean population.
15345661 2004 Paraoxonase and superoxide dismutase gene polymorphisms and noise-induced hearing loss.
15256524 2004 Case-control study of genotypes in multiple chemical sensitivity: CYP2D6, NAT1, NAT2, PON1, PON2 and MTHFR.
15232408 2004 Polymorphisms of the paraoxonase gene and risk of preterm delivery.
15166781 2004 Paraoxonase, a cardioprotective enzyme: continuing issues.
15039125 2004 Genotypes and haplotypes predisposing to myocardial infarction: a multilocus case-control study.
15001326 2004 Four paraoxonase gene polymorphisms in 11212 cases of coronary heart disease and 12786 controls: meta-analysis of 43 studies.
14996478 2004 PON1 M/L55 mutation protects high-risk patients against coronary artery disease.
14984433 2004 Interaction between smoking and PON2 Ser311Cys polymorphism as a determinant of the risk of myocardial infarction.
14741412 2004 Possible association between Cys311Ser polymorphism of paraoxonase 2 gene and late-onset Alzheimer's disease in Chinese.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14636952 2003 Human paraoxonase gene cluster polymorphisms as predictors of coronary heart disease risk in the prospective Northwick Park Heart Study II.
12955589 2003 Association of polymorphisms of paraoxonase 1 and 2 genes, alone or in combination, with bone mineral density in community-dwelling Japanese.
12939804 2003 [Associations of Rsa I polymorphism at the 5' flanking region of CYP2E1 and PON2 148 polymorphism in neonates with preterm delivery].
12853948 2003 The DNA sequence of human chromosome 7.
12778447 2003 [The association of paraoxonase 2 gene C311S variant with ischemic stroke in Chinese type 2 diabetes mellitus patients].
12690205 2003 Human chromosome 7: DNA sequence and biology.
12588779 2003 Extensive association analysis between polymorphisms of PON gene cluster with coronary heart disease in Chinese Han population.
12561466 2002 [Association of CYP2E1 of PON2311 polymorphisms in neonates with preterm].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12454802 2003 Association between the severity of angiographic coronary artery disease and paraoxonase gene polymorphisms in the National Heart, Lung, and Blood Institute-sponsored Women's Ischemia Syndrome Evaluation (WISE) study.
12442067 2002 Serum paraoxonase activity and paraoxonase gene polymorphism in type 2 diabetic patients with or without vascular complications.
12433026 2002 The risk of coronary artery disease in population of Taiwan is associated with Cys-Ser 311 polymorphism of human paraoxonase (PON)-2 gene.
12151850 2002 The paraoxonase gene family and coronary heart disease.
12082592 2002 Multi-locus interactions predict risk for post-PTCA restenosis: an approach to the genetic analysis of common complex disease.
11918623 2002 Paraoxonase gene cluster is a genetic marker for early microvascular complications in type 1 diabetes.
11803456 2002 Codon 311 (Cys --> Ser) polymorphism of paraoxonase-2 gene is associated with apolipoprotein E4 allele in both Alzheimer's and vascular dementias.
11768721 2001 An association study of five genetic loci and left ventricular hypertrophy amongst Gulf Arabs.
11692002 2001 Increased common carotid intima-media thickness in UK African Caribbeans and its relation to chronic inflammation and vascular candidate gene polymorphisms.
11676977 2001 Genetic variations of the paraoxonase gene in patients with coronary artery disease.
11579088 2001 Paraoxonase-2 is a ubiquitously expressed protein with antioxidant properties and is capable of preventing cell-mediated oxidative modification of low density lipoprotein.
11512679 2001 Allele frequencies for candidate genes in atherosclerosis and diabetes among Trinidadian neonates.
11257265 2001 PON2 gene variants are associated with clinical manifestations of cardiovascular disease in familial hypercholesterolemia patients.
11206400 2001 Paraoxonase2 polymorphisms are associated with nephropathy in Type II diabetes.
9847074 1998 Toward a complete human genome sequence.
9714608 1998 Human PON2 gene at 7q21.3: cloning, multiple mRNA forms, and missense polymorphisms in the coding sequence.
9443862 1998 DNA polymorphisms in two paraoxonase genes (PON1 and PON2) are associated with the risk of coronary heart disease.
9329371 1997 Paraoxonase-2 gene (PON2) G148 variant associated with elevated fasting plasma glucose in noninsulin-dependent diabetes mellitus.
8661009 1996 The human serum paraoxonase/arylesterase gene (PON1) is one member of a multigene family.