Property Summary

NCBI Gene PubMed Count 973
PubMed Score 2495.31
PubTator Score 2476.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (4)

Disease log2 FC p
adrenocortical carcinoma -2.568 1.9e-05
pancreatic ductal adenocarcinoma liver m... -3.558 1.4e-02
lung cancer 2.200 1.5e-03
lung carcinoma 3.000 2.0e-22

Protein-protein Interaction (5)

Gene RIF (1109)

PMID Text
27166546 PON1 Q192R polymorphism is likely to be a risk factor for cataract development in Pakistani population while PON1 L55M was not found to be associated with cataract.
27085770 Data suggest that serum PON1 activity is up-regulated in subjects treated with cholesterol-lowering agents (fibrates with/without statins) in prevention of cardiovascular disease (CVD) in patients at risk for CVD. [META-ANALYSIS, REVIEW]
26870959 PON1, P2Y12 and COX1 polymorphisms were associated with poorer vascular outcomes in patients with extracranial or intracranial stents.
26829396 Molecular dynamics simulation studies were employed on selected recombinant h-PON1 (rh-PON1) mutants to understand the effect of amino acid substitutions at position 192 on the structural features of the active site of the enzyme.
26773776 genetic association study in population of women in Brazil: Data suggest an SNP in promoter of PON1 [T(-107)C, rs705379] is associated with variations in serum PON1 activity; PON1 is higher with CC genotype; high-fat diet down-regulates PON1 activity.
26769660 Data from Bavarian population suggest serum PON1 (paraoxonase 1) activity is lowest in non-drinkers and highest in people who consume 15-30 g of alcohol/d; serum AE (arylesterase) activity increases with alcohol consumption; associations are weak.
26654051 hPON1 were found to reduce various virulence factors including pyocyanin, rhamnolipid, elastase, staphylolytic LasA protease and alkaline protease in Pseudomonas aeruginosa.
26632904 SIGNIFICANT ASSOCIATIONS WITH CHRONIC HEPATITIS B RISK WERE observed for PON1 rs705382 SNP after adjusting for sex, age, ethnicity, smoking, alcohol consumption, and body mass index IN Chinese POPULATIONS
26567339 Leu-9, Tyr-185, and Tyr-293 of PON1 are importance in binding to HDL and catalytic activity.
26254371 The aim of the present study was to investigate the association between Paraoxonase 1 (PON1) gene polymorphisms Q192R, and L55M in patients with Chronic Myelogenous Leukemia (CML) and Chronic Lymphocytic Leukemia (CLL) patients.
26251874 presence of an association between the PON1 gene polymorphism and serum levels of advanced glycation end products and advanced oxidation protein products in farmers occupationally exposed to pesticides
26241956 QQ, QR, RR, LL, LM, and MM genotypes in the study population were 55.4%, 34.09%, 9.83%, 41.97%, 48.20%, and 9.83%. The Q, R, L, and M allele frequencies were: 0.755, 0.245, 0.67, and 0.33. 192 RR genotype was more prevalent among ACS patients.
26227792 Neither rs13306698 and rs662 was associated with intracerebral hemorrhage.
26193203 PON1 activities were influenced by all three polymorphisms, regardless of the presence of metabolic syndrome.
26178739 low PON-1 activity might contribute to identify individuals susceptible to develop vascular dementia.
26154629 To evaluate the association of the paraoxonase 1 (PON1) gene polymorphisms c.-108C>T, p.L55M, and p.Q192R with the risk of glioma in Southeast Mexico
26103614 role of paraoxonase 1 in atherogenesis
26091975 PON1 rs662 polymorphism is not associated with oxidized lipoprotein lipids and oxLDL in young Finns.
26039660 the presence of the p.192Q variant of PON1 is associated with a beneficial plasma lipid profile but not with carotid atherosclerosis.
26028114 In summary, these findings suggested that PON1 Q192R polymorphism was associated with a reduced risk of the overall cancers, nevertheless, it might increase cancer susceptibility of prostate and lymphoma risk.
26025407 The data from this study indicates that the PON1 192 Q/R polymorphism may be associated with decreased risk of female infertility.
26016451 Pronounced oxidative stress in acute ischemic stroke patients probably led to HDL structural changes, which could further cause an alteration or decrease of PON1 activity.
26009633 a novel association between PLTPa and PON1 activity
25991559 Haplotype containing two risk alleles of PON1 and PON2 genes was significantly associated with disease diabetes mellitus, type 2.
25968808 serum PON1 and arylesterase activities are lower in patients with chronic otitis media, which are associated with an oxidant-antioxidant imbalance
25966589 In the group of Buryats, the HDL cholesterol content (H = 1.548; p = 0.0461) was higher in carriers of genotype QQ(PON1), wherein the concentration of malondialdehyde (H = 13.854, p = 0.0010) was lower in comparison with carriers of genotype RR
25965560 explore the physiological roles of PON1 in disease development, as well as PON1 gene and protein structure, promiscuous activities and the roles of SNPs and ethnicity in determining PON1 activity
25964115 Decreased activities of HDL-associated PON1 (and PON3), and their interaction are associated with the severity of coronary artery disease in type 2 diabetes mellitus patients.
25962362 No evidence that the Q192R and L55M polymorphisms of PON1 impacted on the probability of reaching extreme ages was found although this cannot be completely ruled out.
25956367 L55M, but not Q192R PON1 polymorphism, was significantly associated with reduced polycystic ovary syndrome susceptibility.
25953737 Data suggest cigarette smoke leads to inhibition of hydrolytic activity of paraoxonase isoenzymes (PON1, PON2, PON3) by modification of thiol groups, by interactions with free radicals/heavy metals, or by decreasing HDL level in blood. [REVIEW]
25935173 These findings suggest the association of paraoxonase 1 (PON1) with G6PD deficiency in the Saudi male population studied herein.
25880731 rs705379 of PON1 was associated with carotid plaque in patients treated with radiotherapy for nasopharyngeal carcinoma.
25835425 This study identified that PON1 L55M associated with Vascular Dementia.
25814092 The current study provides new validation data on enzyme PON1 performance.
25801214 An Arab population of Jerusalem has low protective PON1 lactonase activity with high rates of coronary heart disease and diabetes.
25746376 Two PON1 SNPs, rs662 and rs3735590, were found to significantly interact with cigarette smoking to modulate the risk of coronary heart disease in the Singaporean Chinese population.
25741997 results suggest that the protective effect of PON1 rs662 SNP against lung carcinogenesis and the induction of oxidative stress might be modulated by the interaction between PON1 genetic polymorphisms and tobacco smoking
25734763 The Q allele of PON1 was more frequently represented in our studied population (approximately 60%). The Q allele is less efficient than the R allele at metabolizing chlorpyrifos, the most widely used organophosate pesticide in the sampled areas.
25723374 Serum PON1 activity is decreased in patients with papillary thyroid cancer.
25684529 Low serum paraoxonase-1 levels and gene polymorphisms are associated with colorectal cancer.
25668223 Decreased PON1 activity and the deleterious shift in the distribution of lipoprotein subfractions may contribute to the impaired antioxidant status observed in Smith-Lemli-Opitz syndrome
25600537 Our findings indicate an association between the genetic variants of PON1 and BD. The PON1 L55M MM genotype seems to be protective against the development of BD.
25600530 The PON1 192 AA genotype may increase the risk of PD depending on lipid peroxidation.
25575948 The serum lactonase activities and concentrations of PON1 are increased in polycystic ovarian syndrome patients. The increased oxidative stress and the -108C/T, 192Q/R, and 55L/M genetic polymorphisms of PON1 may be associated with these changes.
25530140 the results of this investigation indicated that PON1 RR phenotype may be an important risk factor in asthma disease.
25520116 Decreased paraoxonase 1 is associated with multiple myeloma.
25510689 No differences in PON activity or the PON:ARE activity ratio were found between patients with ovarian cancer and benign ovarian tumors. Tumor size in benign ovarian tumors was positively correlated with ARE and negatively correlated with PON.
25500007 The results indicate that the PON1 Q192R polymorphism is a risk marker for insulin resistance.
25490030 PON-1 and ferroxidase activities in older patients with mild cognitive impairment, late onset Alzheimer's disease or vascular dementia
25464671 Type 2 Diabetes Mellitus being a condition of Oxidative stress has resulted in the reduction of the antioxidant activity of enzyme PON1.
25463530 These findings support our previous results of an adverse cardio-metabolic risk profile associated with prenatal pesticide exposure in children with the PON1 192 R-allele.
25459919 The significant association of PON1 activity with age, HDL-C, LDL-C, sex and IL-6 was confirmed in multivariate analysis.
25445355 STin2, GSTM1, and GSTT1 polymorphisms, and PON1 status would be associated with comorbid tobacco use + mood disorders.
25420483 PON1 and VWF are detectable markers that may predict the severity of stenosis.
25406539 Decreased PON-1 and anti-CCP-2 antibody serum levels were associated with rheumatoid arthritis.
25386619 The rh-PON1 variants and their process of production discussed here will help to develop h-PON1 as a therapeutic candidate
25367762 paraoxonase might play an important role in homocysteine-thiolactone metabolism
25304213 PON1 enhancement of degradation of organophosphates could be a unique and unprecedented mechanism of antidotal action.
25301263 Meta-analysis found no association between the PON1 Q192R and L55M polymorphisms and ALS susceptibility in the overall population in any genetic model
25297118 2 functional single nucleotide polymorphisms of PON1 gene (rs662 and rs854560) and 3 variants of the P2RY12 gene (rs2046934, rs6798347, rs6801273) in samples pooled from average Hungarian Roma and Hungarian population samples, were investigated.
25264968 Results showed no significant difference in the distribution of PON1 genotypes and alleles between fertile and infertile groups. However morphology and motility of sperm were associated with various genotypes of PON1.
25261854 REVIEW: focuses on one functional protein in HDL, paraoxonase 1 (PON1), specifically on the new developments about its interaction with HDL during its maturation
25241610 High levels of paraoxonase were detected in obese children with metabolic syndrome.
25218815 Data show that the functionality of HDL is impaired in acute coronary syndrome patients and that the impairment may be due to oxidative stress and an alteration of paraoxonase 1 (PON1) activities.
25180809 Data suggest two possible reaction mechanisms that might occur during the paraoxonase-1 (PON1) catalysed hydrolysis of phenyl acetate.
25179377 There is a link between systemic inflammatory markers, oxidative stress, the PON192rs662-Q allele and BuChE-non-UU-phenotype and their corresponding enzymatic activity which may be considered as a risk factor for the severity of rheumatoid arthritis.
25155309 The AA genotype of the rs854560 SNPs of the PON1 gene is associated with increased mortality in patients after myocardial infarction in the subpopulation of patients with lowered glomerular filtration rate.
25093614 Unlikely that PON1 genotype/phenotype would influence appreciably an individual's ability to metabolize chlorpyrifos-oxon.
25070982 Maternal PON1 status modulates the effects of repeated gestational chlorpyrifos oxon exposure on fetal-brain gene expression and on inhibition of both maternal and fetal biomarker enzymes.
25038995 The activities of the HDL-associated PON1 and several other anti-inflammatory factors in HDL are in turn negatively regulated by these oxidized lipids.
25038992 PON1 is found exclusively extracellular and associated solely with high-density lipoprotein (HDL) particles in the circulation, and, in part, confers the anti-oxidant and anti-inflammatory properties associated with HDL.
25037113 PON1 Q192R genotypes and genotypes by smoking interactions are risk factors for the MetS that together with lowered HDL and increased body mass and age contribute to the MetS
25036896 In conclusion, these findings suggest that the PON1 Q192R polymorphism has high MAF in GDM in the studied Saudi population.
25027835 Hydrolysis of PO (POase), DZO (DZOase), dihydrocoumarin (lactonase), and phenyl acetate (arylesterase) were evaluated for associations with race, gender, age, and PON1 55/192 SNP genotypes.
24988089 Hyperglycemia might play a significant role in increased oxidative stress, and decreased PON1 activity, resulting in elevated oxLDL, MCP-1 and VCAM levels. This might be one of the causative factors for accelerated atherosclerosis in patients with NIDDM.
24972570 PON1 polymorphisms may have an influence on the risk of developing embryonal tumors.
24965284 Having at least 1 variant allele of rs662, but not rs85460, increased the risk of having Alzheimer disease (AD) and vascular dementia (VaD). PON1 and ApoE genes showed synergistic epistasis, increasing the odds of having both AD and VaD.
24936519 The severity of Behcet disease correlated with the PON1-L55M polymorphism.
24920129 Data indicate no significant correlation between other trace element levels and serum paraoxonase (PON1) and arylesterase (ARE) levels: [ARE]
24918121 PON1 Q192R polymorphism is significantly associated with susceptibility of coronary artery disease (CAD) in the Chinese Han population, and the 192R allele might be an independent predictor for CAD.
24841661 We conclude that the PON1 Q/R192 and GPX1 Pro197Leu gene polymorphisms are not important risk factors in the development of Familial Mediterranean fever.
24834831 Maternal PON1 polymorphisms are associated with child attention deficit hyperactivity disorder-like phenotypes
24833785 PON1 gene polymorphism (rs662 polymorphism)was not found to predict subclinical atherosclerosis in patients with rheumatoid arthritis.
24831724 PON1 basal and salt-stimulated paraoxonase activity as well as arylesterase activity were significantly reduced in COPD patients.
24830418 Activity of PON-1 and oxidative stress may play a role in the pathogenesis of contrast-induced nephropathy in patients ST-segment elevation myocardial infarction undergoing primary percutaneous coronary intervention.
24826966 Drugs used to treat Behcet's disease inhibit serum PON1 isolated from these patients.
24813034 Schizophrenic patients had a decrease in PON1 activity compared with controls.
24793345 genetic polymorphism is associated with atherogenic lipid profile in Tunisian children with type 1 diabetes
24769273 PON-1 activity is more closely related to the HDL particle concentration or large HDL particles than to HDL cholesterol. Impaired PON-1 activity in T2DM is not to a considerable extent explained by altered HDL subfraction levels
24763406 In anterior ST elevation myocardial infarction patients undergoing primary percutaneous coronary intervention decreased PON-1 activity is associated with no-reflow.
24731121 Low serum paraoxonase-1 enzyme activity is associated with esophageal squamous cell carcinoma.
24721823 The PON1 polymorphism and enzyme plasma activity are associated with coronary heart disease occurrence.
24719500 Serum PON1 activity correlates with the number of CD4+ T-cellsin HIV-1-infected individuals.
24706428 Totalxidant status and oxidative stress index measurements did not differ between obese and NAFLD groups. Paraoxonase activities increased significantly as steatosis increased.
24704632 MPO/PON1 ratio could be a useful marker for secondary prevention of coronary artery disease through modulation of HDL function.
24700021 Decreased PON1 activity was independently associated with the extent of thoracic thoracic atherosclerosis, PON1 activity may play a role in pathogenesis of thoracic atherosclerosis besides age, TAS and LDL cholesterol levels.
24682159 Cadmium was associated with lower PON1P.
24679385 Major depression, but not bipolar disorder, was accompanied by lowered PON1 activity. PON1 activity was decreased by smoking and a diagnosis by genotype interaction (i.e. lower PON1 in major depression with the QQ genotype)
24665146 Low PON1 activity was associated with higher mortality of surgical patients with sepsis.
24620935 The neonates have lower PON1 lactonase activity, higher free PON1, different distributions of PON1 in the high-density lipoprotein subclasses as compared with their mother and adults.
24524596 Study shows the evidence for the presence of active paraoxonase 1 in small-dense low-density lipoprotein.
24504666 Positive clinical response to clopidogrel is independent of paraoxonase 1 Q192R and CYP2C19 genetic variants
24501102 Measuring serum PON1 activity may be useful in assessing the development of toxicity risk in acetaminophen toxicity
24500802 TNF-alpha and PON promoter methylation levels could be involved in the susceptibility to stroke and obesity outcome, respectively. The dietary intake and body composition may influence this epigenetic regulation in non-stroke patients
24477584 Our study provided evidence to IDE, PON1, WFS1, POU2F1, IL1alpha and IL1beta associated with T2D in Pakistanis.
24473115 Plasma arylesterase (PON1) activity is positively associated with plasma cholinesterase (ChE) specific activity in a nested case-control study.
24456870 An association of PON1 Q192R genotype was identified in workers with heart rate variability.
24448003 A MeHg*rs705379 interaction was observed for the rs854560 PON1 variant. Blood mercury levels were inversely associated with serum PON1 activities in individual homozygous for the -108T allele.
24440837 no significant correlation could be established between smokers and nonsmokers in terms of mean total antioxidant status, total oxidant status and PON1.
24423117 Increasing fruit and vegetable intake in type 2 diabetes patients increased PON-1 activity in HDL.
24399815 Results indicate that BuChE non-UU phenotype and PON 55M allele are significant risk factors for systemic lupus erythematosus.
24384301 In parallel with PON1 activation and shifts among particles, there are significant changes in apoE which increases notably in HDL2, paralleling the changes in PON1.
24364225 No significant difference in allele and genotype frequencies of all three examined polymorphisms of paraoxonase 1 was found between the atherosclerotic patients and healthy controls.
24314997 Report PON1 levels in renal transplant recipients.
24301778 We conclude that the PON1 55M and PON2 311C alleles are independent risk factors for CAAD in essential hypertension patients from the Xinjiang Han population.
24280342 HDL maturation optimizes PON1 activity
24267244 plasma MPO levels have a significant inverse correlation with PON-1 levels in stable and unstable angina pectoris, suggesting that an imbalance between pro- and anti-oxidants may contribute to progression of coronary plaque instability
24229619 Serum paraoxonase 1 activity levels were lower in patients than controls.Paraoxonase 1 may play a role in the etiology of oral squamous cell carcinoma.
24228251 From the findings of experimental studies, PON1 appears to be cooperatively regulated by inflammation- and oxidative stress-related molecules linked with SAA regulation in humans
24211756 PON1/high-density lipoprotein (HDL)-cholesterol ratio and superoxide dismutase (SOD) correlate positively and may reflect the protection of (HDL)-cholesterol in children under treatment for peritoneal dialysis or for early-stage chronic kidney disease.
24206655 Single nucleotide polymorphism (rs662) of the PON-1 gene was associated with the risk of steroid-induced osteonecrosis of femoral head in the Chinese Han population.
24200861 ligand-selectivity of AhR DNA binding regulating expression of Bax and paraoxonase 1 genes
24186356 lower levels of PON1 activity were associated with an oxidant-antioxidant imbalance. Decreased PON1 activity may be part of the mechanism of SSRI toxicity.
24170778 The conversion of 2-oxo-ticlopidine to M1 was further confirmed with recombinant paraoxonase 1 (PON1) and CES1.
24167353 There is a significant correlation between PON1 activity and the severity of coronary artery disease.
24148525 Serum PON-1 activity were significantly lower in the nasal polyposis group compared to the control group. Endoscopic polyps' scores and paranasal sinus CT scores were negatively correlated with and PON-1 activity.
24147648 lower levels of PON1 activity in plasma of obese women and in the cord blood of their children, relative to normal-weight women
24130171 Single nucleotide polymorphism in PON1 gene is associated with breast cancer.
24123308 Results suggest that histidine residues at positions 115 and 134 are not always needed for the lactonase/arylesterase activities of h-PON1 and force a reconsideration of the current model(s) of the catalytic mechanism of h-PON1.
24100645 The current metaanalysis highlighted results for the risk of association of PON155L with diabetic retinopathy (DR) and that PON2 gene polymorphisms, as well as PON1Q192R, may not confer major genetic risk to diabetic nephropathy or DR.
24080149 Low PON1 activity is associated with a low response to clopidogrel and a high frequency of intra-stent thrombus only in in CYP2C19 loss-of-function carriers carriers.
24057998 The association between organophosphorus pesticide use and Parkinson disease was greater in PON1 192RR and QR genotypes carriers.
24057271 PON1 genotypes could be higher risk for osteoporosis, as determined by reduced BMD.
24028901 Impaired paraoxonase-1 status in obese children may play a role in the onset and development of metabolic alterations in childhood obesity leading to diabetes and cardiovascular disease later in life.
24028323 Elevated expression of catalase and PON1 suggests protective roles for these antioxidants in NASH livers from pediatric patients.
24024900 Owing to the importance of PON1 to HDL function and its individual association with diverse human diseases, pharmacogenomic interactions between PON1 and the various factors that alter its expression
23993903 Both PON1 Q192R and CYP2C19*2 genotypes influence clopidogrel responsiveness, with the impact of PON1 Q192R mainly on relative platelet inhibition instead of OTPR of clopidogrel.
23936524 Single nucleotide polymorphism in paraoxonase is associated with cardiovascular disease.
23917967 The current findings suggest a relationship of the genetic determinants and activity of paraoxonase 1 to cardiovascular risk in rheumatoid arthritis patients.
23908111 HDL serves as a scaffold upon which MPO and PON1 interact during inflammation, whereupon PON1 binding partially inhibits MPO activity.
23893804 PON-55 M/M genotype is a risk factor for Systemic lupus erythematosus (SLE) patients.
23884836 Association of serum paraoxonase activity and coronary artery calcification
23865359 Investigated and found serum PON1 and ARE enzyme activities were statistically significantly reduced in patients with mitral regurgitation and aortic regurgitation.
23850044 The PON1-Q192R SNP was not associated with platelet clopidogrel reactivity or outcome in acute coronary syndrome.
23834345 Our results indicate that recurrent aphthous stomatitis is associated with decreased PON1 activity and increased oxidative stress that plays a crucial role in its pathogenesis.
23821382 A significant association of PON1 gene promoter activity with PON1 -108C>T and p.Q192R polymorphisms is associated with increased risk for dementia.
23791833 IL-6 upregulates PON1 gene expression through an AKT/NF-kappaB signaling axis in human hepatocyte-derived HepG2 cell line.
23789921 SNP rs854566 was negatively associated with childhood obesity and with increased serum PON1 activities in prepubertal children.
23768700 Enhanced HDL-cholesterol-associated anti-oxidant PON-1 activity has been described in prostate cancer patients.
23742759 Individuals homozygous for the R allele of the PON1 gene and the C allele of the PON2 gene are more likely to have an increased risk of coronary artery disease.
23710701 In rugby players PON1 changes during maximal exercise depend on age, body composition, and training experience.
23709379 PON1 decreases in central obesity, exacerbating obesity-related inflammation and oxidative stress.
23706841 The relationship between PON1 activity, lipid hydroperoxide level, and lipid peroxidation in generalized anxiety disorder has been shown.
23688862 Genetic risk for adverse cardiovascular events can be anticipated for carriers of the haplotype PON1192RR/55MM upon pesticide exposure.
23680251 PON1 levels were found to be a better predictor than HDL cholesterol for atherosclerotic risk in type 2 diabetes mellitus.
23672526 there is a relationship of paraoxonase-1 Q192R polymorphisms and the severity of lung disease in sulfur mustard-exposed patients.
23669169 Serum PON1 and arylesterase activities in relapsing-remitting multiple sclerosis (RRMS) patients are lower, but not significantly, than those of healthy controls. Additional antioxidant treatment might be beneficial for these patients.
23658746 PON1 genetic polymorphism may play a role in early childhood obesity independently from genetic ancestry.
23651475 this study shows that the PON1 GG genotype in rs662 polymorphism could be a risk factor for B-cell lymphomas.
23637274 Decreased serum PON1 and ARE activity is related to poor prognosis in patients with sepsis.
23628180 genetic polymorphism is associated with in Takayasu's arteritis disease in Mexicans
23625910 toxicogenetics/genetic association study in population in Turkey: Data suggest SNP in PON1 (192Q/R) is associated with susceptibility to organophosphate poisoning; plasma ACHE activities of exposed workers vary w/ PON1 genotype: 192RR>192QR>192QQ.
23625196 Data indicate the Q192R polymorphism as a risk factor for CAD in the Saudi population and suggests that it may have prognostic value.
23608957 the haplotype-bearing PON1 -126C allele contributes to the disease risk and the risk of bleeding events in dual antiplatelet-treated CAD patients after percutaneous coronary intervention.
23606795 The serum PON1 activity is probably important in the inhibition of OxLDL in preeclampsia.
23602893 paraoxonase 1 modify the effects of organophosphate pesticides on Parkinson's disease risk
23590198 The current meta-analysis indicates that the PON1 192Q and 55LM polymorphisms may increase the risk of organophosphate toxicity, especially among the Caucasian populations.[meta-analysis]
23582715 Suggest that PON1 decreases sustained pro-inflammatory reactions, which subsequently can attenuate plaque progression.
23557751 In patients with CKD, there was decreased serum arylesterase activity, a measure of diminished antioxidant properties of PON-1. This was associated with higher risk of incident long-term adverse cardiovascular events.
23551806 Data suggest that cord blood PON1 levels in babies born to severely pre-eclamptic mothers are higher than those in babies born to moderately pre-eclamptic mothers; no differences were observed in venous blood PON1 on 7th day of life.
23547806 Reduced PON1 activity is significantly associated with increased carotid atherosclerosis in renal transplant patients.
23538572 The authors found that subjects with the PON1 MM and QQ genotypes had a lower risk of AMD.
23508039 PON1 is responsible for some of the HDL antiatherogenic characteristics. [Review]
23497787 We show that the miR-single nucleotide polymorhpism at PON1 could affect genetic expression and is associated with an elevated risk for ischemic stroke and subclinical atherosclerosis.
23487294 The polymorphisms of the PON genes studied are not related to increased risk of MS in the Polish population.
23471031 Our study provides preliminary evidence that PON1 may play a role in protecting against iron-induced oxidative stress in hereditary hemochromatosis
23442176 PON1 is a novel diagnostic biomarker for microvascular invasion in hepatocellular carcinoma.
23441349 A scatter plot of diazoxonase activity versus paroxonase activity segregated into three distinct groups representing PON1-192QQ, PON1-192QR, and PON1-192RR genotypes.
23441121 The frequency of the paraoxonase 1 (PON1) 55 LL genotype is significantly lower in patients with retinal vein occlusion than in control subjects.
23438848 PON1 plays an important role in pancreatic cancer.
23435062 the association between maternal PON1 polymorphisms (PON1192Q/R, PON155 L/M y PON1-108C/T) and the risk of miscarriage in women chronically exposed to organophosphate pesticides in Mexico
23426541 Paraoxonase 1 and arylesterase levels are important in evaluating the inflammation at the remission period of Familial Mediterranean Fever
23418418 in coronary artery disease, PON1 Q-allele is an independent predictor of worse cardiovascular outcome independent of platelet function and is associated with significantly higher levels of small dense LDL-C.
23406590 Plasma PON1 and total oxidant status levels may serve as predictors of disease severity in children with allergic rhinitis (AR) and both of them appear to be attractive candidates for modulating inflammation in AR.
23391848 There was no rs854563 and rs662 of PON1 gene for risk of coronary atherosclerosis.
23370296 PON1 genotype distribution in sulfur mustard-exposed veterans with severe lung compications was not different from that of controls.
23356507 single nucleotide polymorphisms of PON1 gene may be a risk factor of stroke in the Han Chinese population
23346768 Results of a multivariable linear regression model demonstrated that PON1 192R allele carriage was not independently associated with ADP-induced maximum platelet aggregation measurements
23316782 In the present study, incubation of PON1 with THP-1 macrophages, with MPM, or with J774A.1 macrophages, significantly stabilized the enzyme and increased PON1 catalytic activity
23305304 Study emphasizes PON1 activity as a potential anti-atherogenic element and proposes involvement of cholinesterase activities in its effects.
23278234 The decreased PON1 activity-associated PON1-108 TT and the PON1-192 RR genotypes are more frequently found in Greek polycystic ovary syndrome women and are associated with hyperandrogenaemia
23207490 PON1 promoter genotype regulates low density lipoprotein (LDL) oxidation pathways in Alzheimer's disease patients.
23204156 PON-1 192QR+RR carriers appear the targets for walnut enriched meat consumption as they increased enzyme activities and gamma-tocopherol levels and decreased lipoperoxides.
23182497 The multivariate analysis showed that the PON1/HDL-C ratio was also significantly positively associated with the presence of metabolic syndrome
23171143 PON1192R allele was not significantly associated with coronary artery disease (CAD)in Asian Indian women, ApoB levels were associated with the PON1 "R" allele in Indian CAD women.
23167629 Review includes a summary and discussion of the current findings evaluating the role of SNPs of the myeloperoxidase (MPO) and paraoxanase (PON) genes in cancer occurrence and development. Most of the studies focused on 3 common variations: rs2333227 (MPO), rs854560 (PON1), and rs662 (PON1).[Review]
23160181 common and rare variants in FTO, SERPINA12, and ITGAL predict PON1 acti
23159884 When compared to H115W alone, we found that H115W/Y71A and H115W/F347W maintained VX catalytic efficiency but showed mixed results for the capacity to hydrolyze paraoxon.
23137417 Data confirm functional changes in HDL particles in type 2 diabetes; efflux-HDL from macrophages is reduced depending upon decrease in PON1 activity, which was inversely related to hemoglobin A1c level (glycemic control).
23103709 Serum PON1 activity in diabetic patients having complications was significantly decreased compared to those without complications and healthy individuals
23068968 Findings suggest that oxidative stress may play an important role in the pathogenesis of vitiligo. Paraoxonase 1 can be used as an indicator in determining oxidative stress existent in the pathogenesis of vitiligo diseases.
23056015 The diminution in the paraoxonase-1 and arylesterase activities could contribute to the accelerated development of atherosclerosis in patients with chronic hepatitis B.
23054002 The presence of the 192 R allele of PON1 potentiates the risk of stroke especially in hypertensive people.
23053877 In the presence of metabolic syndrome and diabetes, PON1-192RR was associated with an increased risk of significant coronary stenosis and PON1-55MM seems to have lower risk.
23007074 Our results show that the reduced PON1 activity in hemodialysis patients who are not under statin therapy is strongly associated with inflammation, longer time on dialysis and high rhEPO doses.
22982463 Despite the strong genetic effects of the PON locus on serum paraoxonase and arylesterase activities, the identified variants were not associated with risk of incident cardiovascular disease.
22976839 The NQO1 rs1800566 (C609T), PON1 rs854560 (L55M), and PON1 rs662 (Q192R) polymorphisms modified risk depending on leukemia subtype (decreased in AML, increased and decreased in ALL, respectively), age strata, and variant genotype combinations.
22975224 Results suggest that workers retained the capacity to detoxify chlorpyrifos-oxon under the exposure conditions experienced by this study population regardless of PON1 genotype and activity and that effects of CPF exposure on PON1 activity are minimal.
22974728 PON1 genetic variation influences post-clopidogrel platelet reactivity in Chinese patients.
22971504 The PON1 RR genotype was associated with a significantly lower level of serum reactive oxygen metabolites than the RQ and QQ genotypes.
22959975 results emphasize the dependency of PON1 activity to prevailing oxidative stress during human aging
22956172 It was our goal to expand the knowledge of effects of PON1 gene sequences beyond protein isoforms and to investigate the influence of the upstream regulatory regions on AMD
22952763 PON1 expression directly decreased superoxide anion levels and altered bacterial colonization of the gut
22934769 PON1 and oxidized-LDL are important predictors of coronary artery disease, however they may not be directly related to sleep-disordered breathing.
22896672 Dietary cholesterol was positively associated and predicted 5.5% of PON1 activity, second in variance explained.
22890407 HDL from participants with higher serum PON1 was more effective in impeding glycation of LDL and the related processes.
22884547 data from the present study suggest that these SNPs of the PON gene cluster do not contribute to the risk for developing SALS in a Chinese population.
22868806 Paraoxonases (PON) are antioxidant and anti-inflammatory enzymes that inhibit the production of the monocyte chemoattractant protein-1 (MCP-1).
22854640 The PON1-108 polymorphism may be associated with mean arterial pressure in an age-dependent manner
22847926 PON1 Gln192Arg and CYP2A6*9(-48T>G) polymorphisms were associated with DNA damage induced by pesticides and cell death in Brazilian tobacco farmers.
22846213 No association between coronary artery calcification and PON1 was found.
22835076 In this study, association of the PON1 55 M allele with serum arylesterase (ARE) activity, malondialdehyde (MDA), lipid profiles and psoriasis was investigated
22822045 The levels of lipid hydroperoxides and the activity of paraoxonase-1 (PON1), in 30 subjects of 'normal' weight (18.5-25 kg/m(2)), 15 Prader-Willi syndrome obese (>30 kg/m(2)) subjects, were evaluated.
22813564 PONI is definitely associated with development of the complications of diabetes.
22800774 investigation of the association between PON1 gene polymorphisms (M55L and Q192R) and lymphohaematopoietic cancers (LHC) in an agricultural region of Greece; found no association between M55L polymorphism and LHC; PON1 polymorphisms may influence the risk for LHC in this agricultural area
22796398 The higher frequency of the Gln192Arg polymorphism among Fabry Disease patients highlighted the possibility of a correlation between the PON1 genetic variation and the disease phenotypes.
22776645 PON1 gene polymorphisms (Q192R, L55M) were unlikely to contribute to Alzheimer disease susceptibility.
22751611 Data indicate that the glycan differences of serum paraoxonase 1 (PON1) might serve as potential glycan biomarkers for distinguishing early hepatocellular carcinoma (HCC) from cirrhosis (LC) patients.
22750797 only one SNP at a single locus but several haplotype combinations of PON1 coding and promoter-region polymorphisms were associated with the risk of or protection against coronary artery disease
22750393 beta-carotene reverses the IL-1beta-mediated reduction in paraoxonase-1 expression via induction of the CaMKKII pathway in human endothelial cells
22723959 We conclude that in a Taiwanese population, PON1 Q192R genotype is not associated with ST development after PCI.
22704918 PON1 is involved in the etiology of parkinson disease(PD) and that higher PON1 levels are reducing the risk for PD.
22703625 Data suggest that serum PON-1 activity (which hydrolyses lipid peroxides in oxidized lipoproteins) is lower in patients with polycystic ovary syndrome (PCOS) than control subjects; oxidative stress may increase risk of cardiovascular disease in PCOS.
22659076 Paraoxonase is a potential marker of survival in patients with breast cancer recurrence.
22631428 Evidence indicates that the Q192R polymorphism (the R allele and RR genotype) of paraoxonase is associated with an increased risk of ischaemic stroke in the general population
22616668 decreased serum PON1 activity may be associated with knee osteoarthritis.
22615820 results indicate a gene-environment interaction between prenatal pesticide exposure and the PON1 gene. Only exposed children with the R-allele developed adverse cardiovascular risk profiles thought to be associated with the R-allele
22568797 Paraoxonase and arylesterase activities in children with iron deficiency anemia and vitamin B12 deficiency anemia
22555481 The results show that the LL genotype might be a risk factor for the development of primary glomerulonephritis whilst the M allele might be a protective factor against its progression
22521594 The results of this meta-analysis suggested that both the PON1 L55M and Q192R polymorphisms were not responsible for Parkinson's disease in Caucasians or Asians.
22520065 meta-analysis suggests that the PON1-Q192R polymorphism has no major impact on the risk of MACE and does not alter the biological response to clopidogrel in clopidogrel-treated patients
22428615 This in vitro study shows that the contribution of PON1 to clopidogrel metabolism is limited at clinically relevant concentrations.
22401958 Differences in amino acid residues in the binding pocket dictate substrate specificity of human paraoxonase 1.
22378349 Increased cardiovascular morbidity of patients with chronic renal failure is not attributable to changes in PON1 activity or its phenotypic distribution.
22367101 The Q192R polymorphism of the PON1 gene may be associated with the risk and prognosis of non-small cell lung cancer in a Chinese Han population.
22333293 lower serum PON1 activity, irrespective of genotypes and haplotypes is a risk factor for development of CAD in North-West Indian Punjabis with type 2 diabetics
22322559 The PON1-55M allele is a risk factor for the development of cancer, in particular for breast cancer. [Meta-analysis]
22320866 Decreased PON1 activity may act as a risk factor for the development of coronary heart disease
22301914 The 192Gln/Arg, but not 55Leu/Met, polymorphism in PON1 is associated with the risk of polycystic ovary syndrome in southwest Chinese women.
22285382 plasma PON1 enzymatic activities in hemodialysis patients is not associated with a difference in the phenotype distribution of PON1.
22247228 Decreased PON1 lactonase activity is associated with cardiovascular disease.
22222492 Decreased serum PON-1 activity may, in part, be influenced by higher levels of linoleic acid and lower levels of docosahexanoic fatty acids in type 2 diabetic patients.
22206979 The results indicated that the PON1 Arg192Glu (rs662) and SOD2 Val16Ala (rs4880) variant genotypes were associated with a significantly higher risk of male infertility.
22193970 the consequence of glycation-induced alterations and their effect on overall enzymatic activity
22188760 Authors conclude that serum PONase might be a more relevant marker than PON1 genotype in evaluating the extent and severity of atherosclerosis.
22168506 PON1 activity was lower in women with polycystic ovary syndrome than in the control women (p<0.001).
22133529 PON1 M and Q alleles are associated with a higher risk of breast cancer
22123566 An abnormal lipoprotein profile associated with hypertriglyceridemia, low levels of c-HDL, high levels of c-LDL and significant decrease of PON1 activity.
22115701 Paraoxonase activity also demonstrated a significant association with increased levels of ankle-brachial index (R=0.267, P=0.0255).
22098435 evidence of increased oxidative DNA damage was determined in AD patients as well as decreased serum PON1 activity
22086979 Data suggest that PON1 is major enzyme in plasma that catalyzes bioactivating hydrolysis of prodrug olmesartan medoxomil. Study includes isolation, further substrate specificity, amino acid sequencing, calcium ion requirement, and HDL association.
22074696 Changes in paraoxonase-1 status during pregnancy are associated with maternal oxidative stress status and smoking habits.
22067439 PON1 is involved in the anti-inflammatory effect of high density lipoproteins (HDL), an effect which appears to depend on PON1's association with HDL.
22030099 This meta-analysis demonstrated that decreasing in PON1 activity is a risk factor associated with increased coronary heart disease susceptibility.
22029190 Lower PON1 and high xanthine oxidase enzyme activities cause an imbalance of the free radical system.
21997314 The activity of PON and ARE were significantly decreased, and oxidative stress was increased in patients with subclinical hypothyroidism.
21986144 Low PON1 activity is associated with pre-eclampsia.
21982484 There was an interaction between folate intake and PON1 Q192 polymorphism with regard to the risk of ischemic stroke in white subjects.
21960992 Low levels of serum paraoxonase 1 activities are characteristic of metabolic syndrome and may influence the metabolic-syndrome-related risk of coronary artery disease.
21960140 Increasing PON1 activity assessed by the hydrolysis of PhAc is associated with decreased odds of atherosclerosis in a group of African American and Caucasian Southerners.
21918510 PON1 polymorphisms are not associated with increased risk of in-hospital death and major cardiovascular events.
21911985 Because of the protective role of PON1 in the development of atherosclerosis, a decrease in serum PON1 activity due to lead exposure may render individuals more susceptible to atherosclerosis.
21907728 results indicate that the PON1 and CYP2D6 genotypes can modulate DNA damage elicited by some organophosphate pesticides possibly through gene-environment interactions
21904599 Infants whose PON1 genotype and enzyme activity levels suggested that they might be more susceptible to the effects of OP pesticide exposure had decreased fetal growth and length of gestation
21887553 Studies show null significant association between LEP G2548A, LEPR Q223R, LEPR Lys109Arg, or PON1 Q192R polymorphism and breast cancer risk.
21873946 The increase of PON1 activity in patients' serum in relation to the control groups indicates a probable pathogenic role of the increased formation of reactive oxygen species in the course of osteoarthrosis.
21864557 genome in combination with organophosphate exposure in populations with neurodegenerative diseases
21829028 No significant differences were observed between carriers and non-carriers of the PON1 SNPs in terms of treatment response Alzheimer disease
21820612 Data suggest that the PON1 allele 192R is a risk factor for preeclampsia.
21806387 Neither ABCB1 nor PON-1 genotypes significantly influenced platelet reactivity or outcome.
21803130 Data indicate that QR, RR (Q192R) and GC, CC (-909G/C) genotypes and L-C-A-R-G, L-T-A-R-G, L-T-G-Q-C haplotypes showed significant association with type 2 diabetes.
21783258 Bipolar I disorder was significantly associated with L55M and Q192R polymorphisms, these polymorphisms may play a role for development of bipolar I disorder.
21765051 Single-nucleotide polymorphisms in PON1 is associated with chronic kidney disease in Type 2 diabetes.
21757906 the studied PON1 polymorphism is not associated with late-onset Alzheimer's disease
21755523 PON-1 55 L/M and 192Q/R polymorphisms and allelic variants are not related with the risk for migraine in Turkish people.
21748243 gout patients were in a state of oxidative stress and the protective effects of HDL against atherosclerosis maybe dependent on PON1 activity
21737961 Reduced PON1 activity is significantly associated with increased arterial stiffness. The results of this study show the possible role of PON1 for arterial stiffening in renal transplant recipients
21737645 PON1 192 polymorphsim is associated with an increased risk of lung cancer in the Turkish population.
21723555 lower PON1 activity is associated with an oxidant-antioxidant imbalance that may contribute to atherosclerosis in adult patients with nephrotic syndrome
21722818 higher serum amyloid A levels contribute to impaired high density lipoprotein anti-oxidative function in metabolic syndrome via an effect on PON-1 regulation
21718208 Polymorphisms within PON1 are associated with hypertension and hepatitis in a pesticide exposed rural population in Greece.
21692977 Letter: PON1 R102Q polymorphism does not appear to play a role in determining clopidogrel responsiveness.
21681430 PON1-192Arg and the angiotensin-converting enzyme (ACE) D alleles act synergistically to influence of severity of coronary artery disease.
21672555 Both paraoxonases are expressed in the human frontal cortex; PON2 but not PON1 mRNA levels are up-regulated in Alzheimer disease.
21655055 The 192QR genetic polymorphism in the coding region of PON1 is primarily associated with serum PON1 activity, the intronic polymorphisms are also involved in serum PON1 activity, and this association may be mediated by linkage disequilibrium.
21629682 Data shows that CAD patients had lower PONase and AREase activities as compared to the controls.
21620813 polymorphisms of pon1 gene affect PON1 paraoxonase activity while S311C polymorphism of pon2 gene might be associated with coronary heart disease
21573798 Evidence for an association between PON1 gene polymorphisms and the risk of metabolic syndrome.
21561808 Polymorphisms within Pon1, Pon2, and GSTM1 are associated with male infertility.
21557696 PON1 activity appears not to be affected in PCOS without Metabolic syndrome X and insulin resistance.
21545792 The aim of this study was to estimate the serum activity of paraoxonase 1(PON1) and assess the distribution of PON1 polymorphisms in multiple sclerosis patients in the relapse phase.
21539819 Serum arylesterase activities were significantly lower in migraineurs.
21530644 Both atherogenic pathways are suppressed by PON1, which acts as an antiatherogenic element
21527445 The PON1 Q192R genotype did not influence platelet response to clopidogrel or the risk of ST in clopidogrel-treated patients, whereas the CYP2C19*2 genotype impacted on both antiplatelet effect of clopidogrel and risk of coronary ST
21521796 Human PON1 is the major enzyme for the catalytic efficiency of pilocarpine hydrolysis.
21505009 PON1 192RR and 55LL genotypes are associated with higher PON activity than QQ and MM genotypes of Turkish diabetic patients.
21465165 PON1-Arg-192 allele can be important independent risk factor of coronary artery disease in a west population of Iran.
21450592 Multifactor dimensionality reduction analysis of MTHFR, PAI-1, ACE, PON1, and eNOS gene polymorphisms in patients with early onset coronary artery disease.
21446159 The risk of illness of T2DM for RR homozygotes 1,86-times higher than in general population but is not significant.
21438666 Our data suggest that Type 2 diabetes mellitus individuals with PON1 192R and APOA5-1131 C alleles have a high risk of developing coronary artery disease in a South Indian population.
21427447 Serum PON1 activity is decreased in beta-thalassaemia-trait subjects. Decrease in PON1 activity is associated with the degree of oxidative stress, anaemia and increase in carotid artery intima-media thickness.
21407247 Significant decreases (at least P<0.05) were observed in sICAM concentrations in PON-1 55LM+MM, PON-1 QQ192 and APOA4-2 carriers while decreases in sVCAM in QR+RR and APOA4-1 carriers were observed.
21360915 In CAD patients, particularly in smokers, occurrence of MTHFR and PON1 risk alleles is associated with the decreased adiponectin levels and/or increased degree of insulin resistance.
21355294 The -108 C/T polymorphism in the promoter of PON1 gene was not associated with hormonal levels, glucose metabolism and oxidative stress in women with polycystic ovary syndrome.
21308654 Significant differences in the PON1 Q192R polymorphism were found between renal cell cancer patients and controls.
21302675 The association between PON1 polymorphisms and coronary heart disease(CHD) risk was demonstrated in aThai population. These new data underscore the essence of ethnic variations in the interpretation of CHD associated with PON1 polymorphism.
21291901 Paraoxonase-1 genetic polymorphisms are associated with DNA damage in workers exposed to organophosphate pesticides.
21287574 African populations exhibit higher frequency of coronary artery spasm-associated Q192R polymorphism in PON1.
21268919 Gene polymorphisms of PON could be one of the possibilities genetic conditioning of atherosclerosis.
21258965 serum paraoxonase activity significantly decreased with age
21231776 there is a weak association between the M55L polymorphism in the PON1 gene and C-reactive protein levels
21229382 results suggest that the paraoxonase 1 M allele of L55M polymorphism could be a suitable marker for breast neoplasms susceptibility and tumor prognosis in Egyptian women
21223956 observed a three times significant effect of Q/R 192 PON1 polymorphism on the susceptibility to the occurrence of complications
21187701 PON1 polymorphisms could be one of useful genetic markers for osteoporotic fractures (OFs) risk in postmenopausal women.
21170047 PON1 as a key factor for the bioactivation and clinical activity of clopidogrel and its efficacy after stent implantation.
21167145 Paraoxonase 192R polymorphism may play a minor role as a risk marker for developing lacunar infarctions in a group of Iranian population.
21162838 PON1-192 and GST T1 gene were associated with the farmer's health condition after pesticides exposure.
21146823 This meta-analysis suggested an overall weak association between the PON1 polymorphisms and coronary heart disease risk.
21127310 the PON1 55M and PON1 192R alleles were associated with decreased sperm motility whereas the PON2 311C allele was associated with decreased concentration, supporting the significance of PON genes in semen quality.
21123122 The present data suggest that defining (192)Q and (192)R PON1 isoforms could be a good predictor and prognostic marker in the cardiovascular risk assessment.
21118365 in hemodialysis patients, frequency distribution of PON ratio showed 3 PON phenotypes: 74% oshowed PON1, 21% PON2, and 5% PON3. Compared to hemodialysis patients with PON1, patients with PON2 or 3 showed higher conversion rates for 4-nitrophenylacetate
21111108 PON1 polymorphism shows increased risk of preterm delivery in Korean women.
21108196 Reduced paraoxonase 1 (PON1) activity may play a role in the pathogenesis of atherosclerosis through increased susceptibility to lipid peroxidation in patients with MetS.
21104436 PON1 192 wild type genotypes may be associated with a risk of developing osteosarcoma.
21078685 The allele R of the Q192R polymorphism of paraoxonase-1 is associated with an increased risk for development of obesity among Portuguese Caucasian premenopausal women.
21078685 Observational study of gene-disease association. (HuGE Navigator)
21059866 The lower paraoxonase and arylesterase activities in metabolic syndrome may be considered an independent risk factor for cardiovascular disease, which remains to be cleared.
21044882 The antiatherogenic properties of HDL could be, at least in part, related to the sulfhydryl-reducing characteristics of its associated PON1, which are further protected and recycled by the sulfhydryl amino acid cysteine.
21044781 Observational study of gene-disease association. (HuGE Navigator)
21039385 Observational study of gene-disease association. (HuGE Navigator)
21031563 PON1 polymorphisms are relevant risk factors for having offspring affected with spina bifida in this population from Southeast Mexico.
21031563 Observational study of gene-disease association. (HuGE Navigator)
20981111 hPON1 in mice functions as a prophylactic and offers significant protection against lethal doses of diazoxon.
20980077 Low serum paraoxonase (PON) activity is a risk factor for Alzheimer disease; furthermore, multiple variants in PON influence serum paraoxonase activity and their effects may be synergistic.
20980077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20961187 ESRD patients maybe more susceptible to lipid peroxidation and to protein homocysteinylation than healthy subjects due to the decreased activity of paraoxonase 1 lactonase.
20947215 results suggest that either these functional PON1 polymorphisms are not associated with Alzheimer's disease and Parkinson's disease spectrum disorders, or that the relative risk conferred is small
20947215 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20934178 paraoxonase components PON1, PON2, and PON3 are regulated by diverse nutritional molecules and pharmacological agents and pathophysiological events, such as oxidative stress and inflammation [review]
20921272 the R allele at position 192 on PON1 was associated with a lower rate of serum diazoxon hydrolysis as was the M allele at position 55.8; the polymorphism at position 55 was not predictive of reports of dippers' flu in any of the study subgroups.
20921272 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20883119 Observational study of gene-disease association. (HuGE Navigator)
20872564 paraoxonase 1 Q/R192 gene polymorphisms are associated with coronary artery stenosis.
20856122 in agreement with observations in coronary artery disease, PON1 rs662 appears to be associated with a small increase in the risk of ischemic stroke [review]
20856122 Meta-analysis of gene-disease association. (HuGE Navigator)
20855565 Observational study of gene-disease association. (HuGE Navigator)
20850524 PON1 is not a fixed component of HDL and could also exert its protective functions outside the lipoprotein environment.
20845892 PON-1 activity is lower in patients with calcific aortic stenosis. In addition, PON-1 activity was inversely correlated with the severity of aortic stenosis.
20839225 These functional effects of PON1, PON2, PON3 variation should be considered in protecting vulnerable subpopulations from organophosphate pesticides and other inducers of oxidative stress.
20839225 Observational study of gene-disease association. (HuGE Navigator)
20833162 Results showed a significant and independent association between the PON1 Q192R polymorphism (presence of R allele) and MI in the Tunisian population.
20833162 Observational study of gene-disease association. (HuGE Navigator)
20820904 Correlations were found between the PON1 55 and PON1 192 genotypes and diabetic complications.
20820904 Observational study of gene-disease association. (HuGE Navigator)
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20812194 Data show that the PON1 55MM genotype is a risk factor for rheumatoid arthritis.
20807524 Data suggest that decreased HDL concentration as well as lower PON1 concentration (shown indirectly by the enzyme arylesterase activity) might contribute, at least partly, to the reduced PON1 activity observed in hemodialyzed patients.
20802378 Observational study of genetic testing. (HuGE Navigator)
20734577 data suggest the existence of a synergistic effect of the PON1 RR192 genotype (with lower antioxidant ability) and HDL-deficient subjects in risk for development of coronary artery disease
20734577 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20723250 Common nonsynonymous PON1 polymorphisms are not related with the risk of developing astrocytoma and meningioma.
20723250 Observational study of gene-disease association. (HuGE Navigator)
20709049 The diabetic Lipoprotein HDL2 phenotype is associated with hyperglycaemia, lower PON1 activity and elevated oxidative stress.
20692246 Deficient erythropoiesis in athletes contributes to impaired PON1 activity.
20691716 In individuals with lower paraoxonase 1 activity a stronger association was found between organophosphate pesticide exposure and thyroid function.
20691716 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20679960 Observational study of gene-disease association. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20664283 PON1 polymorphisms modify the association between serum concentrations of lycopene and oxidative stress parameters and bone turnover markers and may, therefore, moderate the risk of osteoporosis.
20664283 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20658496 The findings demonstrate a complex interplay between PON-1 gene variants and PON activities as measured by different substrates.
20658496 Observational study of gene-disease association. (HuGE Navigator)
20646512 The PON1 gene Q192R polymorphism may be associated with the susceptibility of ischemic stroke in younger adults.
20646512 Observational study of gene-disease association. (HuGE Navigator)
20639675 Two major polymorphic genotypes of the PON1 gene in patients with Fabry disease are correlated with disease manifestations.
20639675 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20625960 The results did not show that the -A162G polymorphism of the PON1 gene is a risk factor of sALS in a Polish population; it may affect, however, bulbar onset of the disease.
20625960 Observational study of gene-disease association. (HuGE Navigator)
20615707 The presence of at least one R allele in PON1 Q192R and a TT allele in OLR rs1050283 were associated with concurrent stenoses
20615707 Observational study of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20582942 We now report that in genomic DNA from individuals with familial and sporadic amyotrophic lateral sclerosis, we have identified at least 7 gene mutations that are predicted to alter PON1, PON2, and PON3 function.
20582942 Observational study of gene-disease association. (HuGE Navigator)
20577119 Observational study of gene-disease association. (HuGE Navigator)
20551012 Vitreous levels of HCTL and PON activity can be markers of diabetic retinopathy.
20538124 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20536507 Observational study of gene-disease association. (HuGE Navigator)
20532959 Meta-analysis of gene-disease association. (HuGE Navigator)
20529763 Observational study of gene-disease association. (HuGE Navigator)
20510879 Estradiol may regulate the specific activity and/or stability of cell surface PON1.
20503442 PON1 protein is much more widely distributed than its mRNA, possibly indicating the delivery of PON1 to various tissues by HDL
20497955 The decreased PON activity may be a possible cardiovascular risk factor in Sjogren Syndrome. Disadvantageous PON1 phenotype distribution may contribute to the decreased PON activity in these patients.
20488557 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20486838 Serum PON1 and high-density lipoprotein levels did not differ in patients with moderately decreased glomerular filtration rates compared to healthy controls.
20485444 Single-nucleotide polymorphism in PON1 is associated with coronary atherosclerosis.
20485444 Observational study of gene-disease association. (HuGE Navigator)
20470383 Abnormalities in the composition of lipids and proteins of HDL particles, including PON1 glycosylation, are associated with the decrease in serum PON1 activity in patients with liver disease
20458968 Observational study of genotype prevalence. (HuGE Navigator)
20458436 Observational study of gene-disease association. (HuGE Navigator)
20453498 A flavonoid-rich diet is positively associated with PON1 arylesterase activity in diabetic foot patients
20453000 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20430392 Observational study of gene-disease association. (HuGE Navigator)
20424303 Observational study of gene-disease association. (HuGE Navigator)
20423481 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20407783 In a study involving Caucasian Spanish subjects, no association is found between genotypes and allelic variants PON1 55LM and PON1 192QR in patients with migraine, when compared with healthy controls.
20407783 Observational study of gene-disease association. (HuGE Navigator)
20406466 Observational study of gene-disease association. (HuGE Navigator)
20403997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20381198 The data of this study suggested that PON1 polymorphisms are not involved in ALS pathogenesis in an Italian population.
20381198 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20375196 PON1 variants increase risk of small-for-gestational-age birth
20375196 Observational study of gene-disease association. (HuGE Navigator)
20362697 No significant association of PON1 192 Q/R polymorphism with longevity was observed. However, an interaction of PON1 192 Q/R with APOE epsilon4 was found, but only in a German sample.
20362697 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20348046 Significant decrease of PON1 activity confirm the high risk of cardiovascular diseases in smokers.
20338154 role of PON1 in risk of disease of exposure
20334584 None of the variants of the Leu55Met PON1 polymorphism was associated with more frequent occurrence of PCOS or metabolic disorders, including insulin resistance.
20334584 Observational study of gene-disease association. (HuGE Navigator)
20227490 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20227257 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20221880 high density lipoprotein apolipoproteins and derivatives affect serum paraoxonase-1 activity and function [review]
20221879 PON1 is affectd by HDL mimetic peptide 4F [review]
20221878 Paraoxonase 1 interactions with HDL, antioxidants and macrophages regulate atherogenesis and are related to the protective role for HDL phospholipids [review]
20221877 paraoxonase-1 has anti-inflammatory properties in atherosclerosis [review]
20221876 PON1 decrease and alterations in adipokine levels in childhood obesity could contribute to an early comencement of obesity [review]
20221875 paraoxonase 1 has a role in the detoxification of homocysteine thiolactone [review]
20221874 Paraoxonase 1 attenuates human plaque atherogenicity [review]
20221873 analysis of PON1 and oxidative stress in human sepsis and an animal model of sepsis [review]
20221868 Paraoxonase 1 is a risk factor for disease or exposure [review]
20221866 paraoxonase-1 activity and expression are altered in liver diseases, and are related to monocyte chemoattractant protein-1 and inflammation
20221865 ApoE mimetic peptide reduces plasma lipid hydroperoxide content with a concomitant increase in HDL paraoxonase activity
20209647 The association of the PONGln/Gln genotype with higher MN frequency suggests that the PON1 genotype is a major determinant of genotoxic risk in individuals exposed to pesticides.
20209647 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20198589 PON1 Q192R polymorphism was not found to be correlated with increased risk for rheumatoid arthritis in this Iranian population.
20198589 Observational study of gene-disease association. (HuGE Navigator)
20185366 Observational study of gene-disease association. (HuGE Navigator)
20156521 A review of PON1 polymorphisms that may affect susceptability to chronic ill-health follwing organophosphates exposure.
20142115 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20140262 Studies indicate assocation of PTGER3 and PON1 genotypes with preterm birth.
20140262 Observational study of gene-disease association. (HuGE Navigator)
20133274 Results suggest a novel function for paraoxonase 1 on the fatty acid composition in the adipose tissue through the positive association of the R allele with saturated fatty acid and of the Q allele with 20:5n3 fatty acid deposition.
20100610 A protective role of paraoxonase-1 against inflammation.
20099504 Serum paraoxonase 1, arylesterase activities and total free sulphydryl group levels were significantly lower in endometrial cancer patients compared to controls
20098041 PON1 amino acid substitution is significantly associated with coronary artery disease.
20098041 Observational study of gene-disease association. (HuGE Navigator)
20097953 it seems that the effects of physical activity on PON1 blood concentration and activity are modified by environmental and lifestyle factors as well as PON1 polymorphism
20078877 Observational study of gene-disease association. (HuGE Navigator)
20078196 Observed significant differences in the haplotype distribution of Paraoxonase-1 between the control subjects and the HIV-infected patients.
20078196 Observational study of gene-disease association. (HuGE Navigator)
20056567 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20050883 PON1 polymorphisms are not related with the risk for essential tremor
20050883 Observational study of gene-disease association. (HuGE Navigator)
20045427 Genetic control of PON1 enzymatic activity varies in Mexican-American children compared to adults and is also affected by pregnancy status.
20045427 Observational study of gene-disease association. (HuGE Navigator)
20042177 We report a weak association of PON1 Leu55Met with an increased risk of wet AMD, replicating previous reports. Our findings indicate a protective role for Gln192Arg, particularly for patients with the wet form
20042177 Observational study of gene-disease association. (HuGE Navigator)
20026099 A significant association between R allele of the PON1 polymorphism and the development of coronary artery disease.
20026099 Observational study of gene-disease association. (HuGE Navigator)
20019917 Lower levels of the PON1 enzyme, which is involved in protection against OPs and oxidative stress, persist in young children past 2 years of age through at least 7 years of age.
20019917 Observational study of gene-disease association. (HuGE Navigator)
19967651 PON1 polymorphisms may contribute to the pathogenesis and course of Henoch-Schonlein purpura.
19967651 Observational study of gene-disease association. (HuGE Navigator)
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19945920 Results show PON1 exists under several active multimeric forms; the binding of HPBP amends the size of the oligomeric states & exerts a stabilizing effect on PON1; PON1 functional properties are modulated by HPBP, calcium and phosphate.
19939821 Observational study of gene-disease association. (HuGE Navigator)
19930448 Observational study of gene-disease association. (HuGE Navigator)
19915520 Altered levels of leptin, adiponectin and PON1 activities may be useful markers beside the general risk factors in childhood obesity.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19907334 Examined associations between Parkinson disease and the influence of polymorphism of the PON1 gene (PON1-55). Carriers of the variant MM PON1-55 genotype exposed to organophosphates exhibited a greater than 2-fold increase in Parkinson disease risk.
19907334 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19904013 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19902814 The PON1 polymorphism was not associated with cerebral hemorrhage or infarction
19902814 Observational study of gene-disease association. (HuGE Navigator)
19902425 The -107TT PON1 genotype was associated with a 1.97 times increased risk for stroke in elderly.
19902425 Observational study of gene-disease association. (HuGE Navigator)
19891963 Results show no significant differences in paraoxonase, oxLDL, or other oxidative stress markers after 2 months of acetylsalicylic acid treatment.
19880629 The findings provide evidence that the Hcy-thiolactonase activity of PON1 is a determinant of plasma N-Hcy-protein levels and that Hcy-thiolactonase/PON1 protects proteins against N-homocysteinylation in vivo.
19878569 Observational study of gene-disease association. (HuGE Navigator)
19863653 These results suggest an involvement of the paraoxonase 1 gene in Alzheimer's disease etiopathology and responses to treatment.
19863653 Observational study of gene-disease association. (HuGE Navigator)
19850020 The alterations in lipoprotein profile, CETP, PON 1 and LpPLA(2) activities described in the present study indicate that non-treated iron deficiency anaemia might represent a proatherogenic state.
19846948 Findings support that genotypical differences of PON1 might contribute to prognosis and pathogenesis of bladder cancer.
19846948 Observational study of gene-disease association. (HuGE Navigator)
19826962 The results of the present study suggest that PON1 polymorphism is not related with the risk for multiple sclerosis.
19826962 Observational study of gene-disease association. (HuGE Navigator)
19818126 Observational study of gene-disease association. (HuGE Navigator)
19778663 Observational study of gene-disease association. (HuGE Navigator)
19770524 PON1-192R allele and RR genotype are significantly associated with CAD patients from the north Indian population (Uttar Pradesh).
19770524 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19750105 Observational study of gene-disease association. (HuGE Navigator)
19736056 Observational study of gene-disease association. (HuGE Navigator)
19729601 Observational study of gene-disease association. (HuGE Navigator)
19710913 shows that PON1-activity inversely relates to CAD risk, but not independent of HDL, due to its close association with the HDL-particle. These data strongly suggest that a low PON1-activity is not a causal factor in atherogenesis
19710913 Observational study of gene-disease association. (HuGE Navigator)
19672401 Data found significant racial differences in the PON1192 functional genotype distribution, with African Americans-the race with higher CVD-displaying a greater proportion of the functional RR genotype.
19672401 Observational study of genotype prevalence. (HuGE Navigator)
19654933 the allele and genotype frequencies of PON polymorphisms were described in a south-western Korean population
19654933 Observational study of gene-disease association. (HuGE Navigator)
19651761 No evidence was found of an association between the PON1 Q192R polymorphism and poor general or mental health in two independent population-based studies.
19651761 Observational study of gene-disease association. (HuGE Navigator)
19646734 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19634497 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19628957 Decreased paraoxonase activity as well as increased adenosine deaminase and xanthine oxidase activities and nitrite levels indicate that oxidative stress is increased and purine metabolism is altered in pseudoexfoliation syndrome.
19615988 Observational study of gene-disease association. (HuGE Navigator)
19602899 Studying the genotype & phenotype distribution of PON1 & its end-product activity in chronic kidney disease patients, renal transplant recipients, & reference subjects showed unexpectedly high phenotype & genotype discordances in all groups.
19602899 Observational study of gene-disease association. (HuGE Navigator)
19597297 Homocysteine level correlated negatively with PON1 activity, and positively with cystatin C level
19587357 Meta-analysis of gene-disease association. (HuGE Navigator)
19579917 Results indicate that angiotensin converting enzyme, paraoxonase 1 192 and PON1 55 gene polymorphisms are not related to genetic susceptibility to syndrome X and/or coronary heart disease in non-smokers.
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19575027 Single-nucleotide polymorphisms, Q192R of the PON1 gene is found to be significantly associated with the risk of asthma.
19575027 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19556304 Development of acute asthma coincides with reduced expression of PON1 in humans. reduced PON1 activity may be involved in the pathogenesis of asthma.
19540141 Observational study of gene-disease association. (HuGE Navigator)
19538950 Data show that the use of the MDA, MPO, AE, NO and PON1 as biomarkers might be useful tools, helping in the monitoring of patients with HCV.
19527514 Observational study of gene-disease association. (HuGE Navigator)
19479237 Observational study of gene-disease association. (HuGE Navigator)
19474728 Studies have demonstrated the antioxidative and atheroprotective effects of PON1.
19454508 frequencies of the PON1 55 LL, MM and LM genotypes among ovarian cancer patients were 0.53, 0.10 and 0.37 and among the control subjects there were 0.46, 0.04 and 0.50, respectively
19454176 Results suggest that PON1 55 and 192 genotypes might have an important role in developing hyperhomocysteinaemia and may also have a role in the pathogenesis of preeclampsia in a Turkish population.
19443958 PON1 polymorphisms are not associated with the risk of coronary heart disease nor do they interact with smoking or monounsaturated fat intake.
19439227 decreased activity in lens tissue of diabetic patients suffering from cataract
19434854 IgG-PON1 fusion protein for targeted drug delivery across the human blood-brain barrier is reported.
19421925 The combined analyses of both polymorphisms revealed that the genotypes IGF-2 (GG)/ PON-1 (TT) and IGF-2 (AA)/ PON-1 (TT) were more frequent in the PCOS group, whereas the genotype IGF-2 (AA)/ PON-1 (CC) did not occur in the PCOS group at all.
19421925 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19420105 Observational study of gene-disease association. (HuGE Navigator)
19401157 Oxidative stress and proinflammatory agents selectively affect the expression of PONs.
19379515 Results show that genetic polymorphisms in biotransformation enzymes CYP17, GSTP1, PON1 and GLO1 could be associated with the risk for breast cancer.
19379515 Observational study of gene-disease association. (HuGE Navigator)
19376276 PON1 gene variants at codon 192 impact on the probability of attaining longevity, and subjects carrying RR and QR genotypes (R+ carriers) are favoured in reaching extreme ages [meta-analysis]
19376276 Meta-analysis of gene-disease association. (HuGE Navigator)
19371607 These results showed a significant joint effect between arsenic exposure and serum PON1 activity on carotid atherosclerosis, suggesting that subjects of low PON1 activity may be more susceptible to arsenic-related cardiovascular disease.
19371607 Observational study of gene-disease association. (HuGE Navigator)
19371602 Knockout and transgenic PON1 mice were used to study the toxicity of organosphosphorus pesticides.
19359600 Human paraoxonase gene cluster transgenic overexpression represses atherogenesis and promotes atherosclerotic plaque stability in ApoE-null mice.
19357718 PON1 G-to-A substitution may be a key player in a common pathway to chronic kidney and cardiovascular diseases in women
19357718 Observational study of gene-disease association. (HuGE Navigator)
19330810 The aim of this work was to evaluate dyslipidemia, oxidative stress, total antioxidant capacity and serum paraoxonase (PON1) and arylesterase (ARE) activities in psoriasis.
19321847 Meta-analysis of gene-disease association. (HuGE Navigator)
19301736 The distribution of PON1 phenotype in Thais is clearly trimodal with high frequency in BB phenotype.
19292048 PON1 L55M gene polymorphism and allelic genes are not associated with the level of fasting blood glucose or diabetes mellitus. There is no evidence to support the relationship between PON1 L55M gene polymorphism and coronary artery lesions.
19292048 Observational study of gene-disease association. (HuGE Navigator)
19288455 study found a negative correlation between PON1 and malondialdehyde in hyperemesis gravidarum (HG) patients; findings of this study have revealed that HG may be one of the conditions in which oxidant and antioxidant balance is impaired
19285487 Observational study of gene-disease association. (HuGE Navigator)
19280995 The PON1 192RR genotype presented a relative risk for CAD 80% higher than in the population without this genotype.
19280995 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19269283 PON1 L55M (MM) genotype frequency was significantly higher in coronary artery diseases patients than in controls (P<0.05).
19269283 Observational study of gene-disease association. (HuGE Navigator)
19263529 Observational study of gene-disease association. (HuGE Navigator)
19261989 A low FMD, abnormal size distribution of HDLs, and low PON1 activity are observed in Takayasu's arteritis patients.
19254215 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19233152 Study showed that hyperhomocysteinemia and low PON1 concentration are associated with chronic renal disease and markedly associated in patients with cardiovascular complications.
19233151 The results suggest that haplotypes observed in the PON1 5'-regulatory region should be considered as risk factors for ischemic stroke
19233151 Observational study of gene-disease association. (HuGE Navigator)
19226538 Results describe the distribution of paraoxonase (PON)1 L/M 55 and Q/R 192 polymorphisms and the effect of these polymorphisms on the activities of PON 1, and on the severity of coronary artery disease.
19226538 Observational study of gene-disease association. (HuGE Navigator)
19223938 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19219535 Genetic variants of PON1 55/192 and MTHFR were associated with coronary artery disease
19219535 Observational study of gene-disease association. (HuGE Navigator)
19207863 HDL-PON1 activity is decreased in type 2 diabetic patients with incipient or overt nephropathy.
19205543 Observational study of gene-disease association. (HuGE Navigator)
19204840 decreased paraoxonase/arylesterase activities may play a role in ethiopathogenesis through increased susceptibility to lipid peroxidation in women with early pregnancy failure.
19201174 Myeloperoxidase is an independent, negative determinant of paraoxonase-1 activity, which may be one mechanism by which it promotes HDL dysfunction and increases cardiovascular risk
19155603 Increased serum homocysteine and malondialdehyde levels may be responsible for the decreased PON1 activity in patients with age-related macular degeneration
19152805 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19151417 The lower mass of PON1, an anti-inflammatory HDL-associated enzyme, in T2DM with cystatin C-eGFR <60 ml/min per 1.73 m(2) may contribute to their increased risk for cardiovascular disease.
19151417 Observational study of gene-disease association. (HuGE Navigator)
19135476 Mean paraoxonase activity is similar among Chinese and Malays exposed to occupational organophosphate whereas that of the Indians is significantly lower.
19135476 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19131662 Meta-analysis of gene-disease association. (HuGE Navigator)
19126404 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19121386 presence in sputum, significant correlation with arylesterase activity; role in protection from smoking toxicity
19104460 Paraoxonase genotypes at previously associated single nucleotide polymorphisms rs662, rs854560, rs6954345 and rs11981433 were studied & a significant interaction with population density for marker rs854560 (L55M) in amyotrophic lateral sclerosis was found
19104460 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19103284 reduces lipid-mediated atherogenic properties, and decreases the macrophage oxidation
19090870 the most significant determinant of carotid intima media thickness was PON1 arylesterase activity in hemodialysis treated chronic renal failure and arylesterase activity and basal PON1 activity in convervative treatment group
19082953 The anti-atherogenic biological activities were studied in vitro using serum or cell cultures, and also in vivo, using PON 1/2/3 knockout or transgenic mice, as well as humans - healthy volunteers and atherosclerotic patients.
19071155 This study describes the adaptation of a non-organophosphorus, two-substrate determination of PON1 status to the conversion of the PON1 status data to physiologically relevant rates of diazoxon and chlorpyrifos oxon detoxication.
19056482 Observational study of gene-disease association. (HuGE Navigator)
19048631 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
19022366 Our results demonstrated an association between the CYP1A1/PON1 polymorphisms and several medical examination findings.
19022366 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
19018779 Polymorphisms of apolipoprotein E and paraoxonase 1 are associated with different levels of thyroid hormone.
19018779 Observational study of gene-disease association. (HuGE Navigator)
19018234 Reduced PON1 activity in patients and their relatives might result from the combined effects of more than one polymorphic variant in PON1 or other genes and/or increased oxidative stress
19018234 Observational study of gene-disease association. (HuGE Navigator)
19015224 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19013297 Up-regulated hepatic PON1 expression under high glucose conditions may be a compensatory mechanism in diabetes in which antioxidant capacity, including PON1 enzymatic activity, is attenuated.
19005291 Lower PON1 activity and higher oxLDL levels may be predicting factors that denote diffuse, severe or multivessel disease in coronary heart disease patients with hyperglycemia.
19003935 55 methionine allele carriers of paraoxonase 1 has 3.6 times more risk of creating general periodontal and gingival problems
19003935 Observational study of gene-disease association. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18977341 Observational study of gene-disease association. (HuGE Navigator)
18976644 Study demonstrates, for the first time, that the arylesterase activity of PON1 is affected by critical ischemia of the lower limbs.
18971955 Observational study of gene-disease association. (HuGE Navigator)
18952040 The method was applied to human serum PON1 polymorphism for nerve gas hydrolytic activity in the coding region(Q192R). PON1-192 and PON1-55 genotypes were determined by gel electrophoresis with restriction enzymes after PCR of blood leukocyte genomic DNA.
18951406 The results suggest that the active site of Human paraoxonase 1 is characterized by two distinct binding regions: the hydrophobic binding site for arylesters/lactones, and the paraoxon binding site for phosphotriesters.
18936436 Observational study of genotype prevalence. (HuGE Navigator)
18930907 Men with abnormal semen parameters have decreased levels of PON-1 activity in their seminal plasma.
18927546 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18923238 Serum paraoxonase activity is independently associated with the degree of coronary collateral flow and reduced serum paraoxonase activity might represent a biochemical marker of impaired coronary collateral flow.
18845659 PON1 activity does not change in the course of stable and progressive type of multiple sclerosis and is decreased in the relapse
18830558 Low concentration and enzymatic activity of PON1 may be an independent predictor of cardiovascular events in diabetic patients.
18830194 Data show that PON1 55/192 and MMP-3 5A/6A genetic variants are associated with coronary artery disease; PON1 is connected with the number of diseased vessels, and hypertension and hyperlipidemia are related with PON1 192 and MMP-3 in CAD patients.
18830194 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18823627 Observational study of gene-disease association. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18796237 Serum HDL-cholesterol, -SH levels, paraoxonase & arylesterase activities were significantly lower in patients with knee osteoarthritis than those in controls, while LOOH and low-density lipoprotein (LDL) levels were significantly higher.
18728123 Observational study of gene-disease association. (HuGE Navigator)
18720901 Observational study of genotype prevalence. (HuGE Navigator)
18716378 As the prevalence of the different alleles and genotypic distribution vary between the Asian populations we studied, proposes the necessity to study PON1 polymorphisms and its role in orthophosphate toxicity in Asian populations.
18708400 PON1 genetic variants may alter the risk of epithelial ovarian cancer among women in a multiethnic population.
18708400 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18695162 Observational study of gene-disease association. (HuGE Navigator)
18678600 expression of the human orthologue (PON1) and found monoallelic or preferential allelic expression in 6/7 and 4/4 samples from liver and pancreas, respectively
18665040 Observational study of gene-disease association. (HuGE Navigator)
18652773 Data suggest that oxidative stress seems to suppress PON1 synthesis in hepatosteatosis patients, and that oxidative stress and oxidant-antioxidant imbalance may be part of the cytotoxic mechanisms leading to liver cell injury.
18635682 Observational study of gene-disease association. (HuGE Navigator)
18634772 Oxidative stress in coronary heart disease patients is maintained by systemic low-grade inflammation, which results in PON1 enzymatic activity exhaustion.
18626964 Reduced Paraoxonase-1 is associated with Crohn's disease and ulcerative colitis.
18624774 Data show that both the bioavailability and the catalytic activity of PON1 are impaired in ASD, despite no association with the Q192R and L55M polymorphisms in the PON1 gene and a normal distribution of the PON1 phenotype.
18624774 Observational study of gene-disease association. (HuGE Navigator)
18618303 Results suggest that a common haplotype within the PON1 promoter region is associated with susceptibility to sporadic amyotrophic lateral sclerosis
18615156 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18601602 PON1 192Q/R polymorphism is the main determinant of PON1 activity in the prepubertal population in this study, accounting for around 70% of serum PON1 activity. HDL-C concentration has a small contribution to serum PON1 activity in girls.
18601602 Observational study of gene-disease association. (HuGE Navigator)
18582459 PON1 polymorphism is associated with lipid profile in Mexican men with Mayan ascendancy.
18582459 Observational study of gene-disease association. (HuGE Navigator)
18569577 Observational study of gene-disease association. (HuGE Navigator)
18550589 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18544231 Paraoxonase-1 activity is low in patients with hyperemesis gravidarum and may play a role in development of atherogenesis
18513389 Observational study of gene-disease association. (HuGE Navigator)
18505467 Low paraoxonase-I activity relates to higher CRP, independently of adipokines, as well as of obesity and lipids. Low paraoxonase-I activity in type 2 diabetes mellitus may contribute to cardiovascular risk via an enhanced systemic low-grade inflammation.
18500687 The Q129R and the L55M SNP of PON1 may be associated with increased risk of aggressive prostate, perhaps through attenuation of paraoxonase l activity.
18500687 Observational study of gene-disease association. (HuGE Navigator)
18497471 In the type 2 diabetes mellitus group flow-mediated vasodilatation was lower among those carrying the Arg allele compared with Gln/Gln homozygotes for the PON1 gene. Hypertension seems to abolish the protective effect of the Gln isoform.
18497471 Observational study of gene-disease association. (HuGE Navigator)
18474147 Oxidative stress increases in sarcoidosis might be due to both increase in lipid peroxidation and decrease in antioxidant status (PON1)
18469206 The MM genotype at PON1 p.Leucine54Methionine is associated with a reduced risk of abnormal plantar fascia thickness.
18469206 Observational study of gene-disease association. (HuGE Navigator)
18465683 Association of serum levels of resistin with PON1 activity, and parameters of metabolic syndrome, including some that are additional for research.
18443916 Data show that of four genes studied -- angiotensin-forming enzyme, PON1, PPAR-gamma, and APOE -- only PPAR-gamma and APOE showed an effect on fertility.
18443916 Observational study of gene-disease association. (HuGE Navigator)
18433845 study associated polymorphism within the PON1 gene promoter haplotypes with the serum arlyesterase activity. arlyesterase activity was also associated with the extent of stenosis in coronary arteries but not with primary development of atherosclerosis
18433845 Observational study of gene-disease association. (HuGE Navigator)
18430447 there exists an interaction between organophosphorous exposure and PON1 polymorphism on all stages of spermatogenesis
18430447 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18430057 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18427977 Observational study of genetic testing. (HuGE Navigator)
18423402 PON1 activity decreases in gastroesophageal cancers and corresponds to inflammation severity and cancer-related anemia.
18413200 Observational study of gene-disease association. (HuGE Navigator)
18385941 observed in other protein oxidation parameters in the groups leading to decreasing PON1 activity might, we think, create a predisposition to atherosclerosis
18361900 results indicate that PON1-192 polymorphism is an independent risk factor of AMI
18361900 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18355454 Reduced paraoxonase in hyperttension may indicate increased oxidative stress, which plays an important role in the development of cardiovascular diseases.
18349088 This study provides direct evidence for a mechanistic link between genetic determinants and activity of PON1 with systemic oxidative stress and prospective cardiovascular risk, indicating a potential mechanism for the atheroprotective function of PON1.
18349088 Observational study of gene-disease association. (HuGE Navigator)
18347314 Our findings suggest that the influence of PON1 polymorphisms on ALS susceptibility is not due to reduced organophosphate hydrolysis.
18347314 Observational study of gene-disease association. (HuGE Navigator)
18347034 The hydrolytic effects of PON1, PON2, and PON3 on the key quorum sensing compound of P.aeruginosa are reported.
18322397 PON1 plays a prominent role in the pathophysiology of common Alzheimer's disease with a marked impact on the cholinergic system and Abeta levels in the brain.
18322397 Observational study of gene-disease association. (HuGE Navigator)
18281420 Paraoxonase may not play an important role during the early pathogenesis of cardiovascular disease. Associations with lipids and glucose suggest that paraoxonase may modify or react to macrovascular disease pathogenesis.
18281420 Observational study of gene-disease association. (HuGE Navigator)
18274205 Observational study of gene-disease association. (HuGE Navigator)
18260892 Observational study of gene-disease association. (HuGE Navigator)
18241625 192Q>R allelic variant of the paraoxonase-1 gene is associated with coronary endothelial dysfunction and contributes to early atherosclerosis in humans.
18241625 Observational study of gene-disease association. (HuGE Navigator)
18236737 This paper represents the study of 64 cases of Hb Q, documenting the haematological and molecular findings on 36 cases of Hb Q trait, 22 of Hb Q beta-thalassaemia trait and three of Hb Q beta-thalassaemia major, and a family of Hb Q homozygous cases.
18219093 an independent protective association between carrier-state of PON1 R allele and coronary artery disease.
18219093 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18164014 Paraoxonase (PON1) may have a role in myocardial infarction in a general population of Dutch women
18164014 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18154731 Patients with active PTB are exposed to potent oxidative stress and they have decreased PON1 activity.
18096166 PON1 is biochemically and genetically associated with familial combined hyperlipidemia
18083534 results strengthened the previous findings of cross-sectional study, suggesting that the 192R allele of PON1 may be a novel genetic risk factor for airway injury among current smokers.
18083534 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18034366 Observational study of gene-disease association. (HuGE Navigator)
18000171 PON-1 activity was significantly lower whereas lipid hydroperoxide levels were significantly higher in women with moderate to severe endometriosis than in women with minimal to mild endometriosis.
17977159 Decreased PON1 activity might contribute to an increased propensity for the development of cardiovascular disease in women with PCOS.
17975119 Observational study of gene-disease association. (HuGE Navigator)
17949258 Report paraoxonase 1 gene polymorphisms and enzyme activities in diabetes mellitus.
17949258 Observational study of gene-disease association. (HuGE Navigator)
17936978 Observational study of gene-disease association. (HuGE Navigator)
17936934 examination of the physiological function of the PON1(192) alloforms in organophosphorus compound detoxication
17936248 Overall, the results of this study indicated that decreased serum PON1 activity should be considered as a risk factor for ischemic stroke in Koreans.
17920578 PON1 activity ratio, PON1 192RR genotype and PON1 status as important risk factors for ischemic stroke.
17920578 Observational study of gene-disease association. (HuGE Navigator)
17900266 Genetic variation in the PON3 gene is associated with serum PON1 activity.
17900266 Observational study of gene-disease association. (HuGE Navigator)
17854416 This study did not provide association between PON gene polymorphisms and ischemic stroke. However, it confirmed that the PON is associated with plasma concentration of total homocysteine and with plasma concentrations of LDL cholesterol and ApoB.
17854416 Observational study of gene-disease association. (HuGE Navigator)
17716225 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17716225 Paraoxonase-1 may play a role in the protection of the airways against the toxicity of cigarette smoke.
17702780 Observational study of gene-disease association. (HuGE Navigator)
17702780 Two of seven SNPs in PON1 and PON3 were associated with SALS in the Irish population
17664137 PON1/2/3 may have extracellular functions as part of the host response in inflammatory bowel diseases and celiac disease
17662690 A statistically significant decrease (p<0.05) was observed for negative acute phase reactants such as plasma paraoxonase-arylesterase (PON-AE) activity and total plasma protein in comparison with admission plasma levels.
17651311 paraoxonase activity & phenotype distribution in serum of healthy Iranians was assessed; distribution of paraoxonase phenotypes in this population was trimodal & comparable to that of Caucasians from North America; but overall enzyme activity was lower
17646900 children with active-stage Henoch-Schonlein purpura had significantly lower PON (paraoxonase ) levels than controls
17624629 We confirmed that the proximal promoter and 5' sequence of the PON1 gene may harbor unknown functional variant(s) associated with the risk of developing AD.
17624629 Observational study of gene-disease association. (HuGE Navigator)
17624354 adiponectin is an independent variable of serum PON1, which may contribute to the anti-atherosclerotic effect of adiponectin
17623520 Results suggest that patients with fibromyalgia were exposed to oxidative stress, and paraoxonase and arylesterase activities were decreased in these patients.
17617032 We suggest that impairment of PON1 activity in patients with beta-thalassemia hemoglobin E may be directly caused by oxidative damage
17617030 Observational study of gene-disease association. (HuGE Navigator)
17617030 This report shows that the 55LeuLeu PON1 genotype increases coronary artery disease(CAD) risk among female Caucasian-Brazilians, irrespective of other CAD risk factors.
17592556 PON1 activity was reduced in both sexes on high-fat fed rats due to a reduction of PON1 mRNA levels in males and to a reduced stability and/or number of HDL particles responsible for PON1 transport in females.
17587252 Observational study of gene-disease association. (HuGE Navigator)
17585031 Observational study of gene-disease association. (HuGE Navigator)
17585031 Both Q192R and L55M polymorphisms modulate the effect of walnut-enriched meat consumption on cardiovascular disease biomarkers.
17568951 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17560461 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17560461 The present study revealed an association between carrier state of Q allele of PON1 gene and coronary artery disease as well as synergistic effects between genotype and some conventional risk factors, mainly smoking and elevated level of total cholesterol
17558807 Observational study of genotype prevalence. (HuGE Navigator)
17558807 the frequencies of PON1-192 and -55 polymorphisms in this Iranian population were different from those seen in other Asian populations from Japan and China but similar to those for European Caucasians
17556053 PON1 association with human phosphate binding protein (HPBP) is essential for preserving its active conformation
17554394 PON1 activity level was found to be significantly lower in erectile dysfunction patients than in the control group.
17539292 Observational study of genotype prevalence. (HuGE Navigator)
17539292 Frequencies of L and R alleles were 0.91 and 0.54, respectively; frequency of the M allele was higher in Indians; the R allele was higher in both the Chinese and Malays. The most common genotypic combination was LL/QR, followed by LL/RR
17536768 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17536768 Risk of ill health attributed to organophosphate-containing sheep dip is associated with PON1 genotype and phenotype varied with CYP2D6 and GSTP1 genotype but not consistently with a priori hypotheses
17532308 Observational study of gene-disease association. (HuGE Navigator)
17532308 PON1 gene exhibited a wide variation in enzyme activities both within and between genotypes which implied insights of a potentially difference in sensitivity to organophosphorus compound toxicity
17532162 Observational study of gene-disease association. (HuGE Navigator)
17532162 PON1 genotypes affect significantly the susceptibility of LDL and HDL to lipid peroxidation.
17469180 Observational study of gene-disease association. (HuGE Navigator)
17469180 We conclude that individuals with PON1 192QQ genotype may have increased risk for osteonecrosis of the femoral head and cerebral white matter lesions.
17463067 Observational study of gene-disease association. (HuGE Navigator)
17463067 Polymorphism in this enzyme and glyoxalase I increase susceptibility to multiple sclerosis.
17460182 analysis of paraoxonase activity changes with age in the Turkish population
17449559 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17437735 Observational study of gene-disease association. (HuGE Navigator)
17436311 Observational study of gene-disease association. (HuGE Navigator)
17436100 Observational study of gene-disease association. (HuGE Navigator)
17435182 We demonstrate these new tests with a group of healthy individuals (n=54) and show that the levels of PON1-HDL vary by a factor of 12.
17428620 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17416287 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17412348 Observational study of gene-disease association. (HuGE Navigator)
17412306 The ability of PON1 to effectively hydrolyze a variety of estrogen esters provides further insight into the structure of its active site.
17373636 oxidative stress occurs at an early stage in diabetes, and protective effects of HDL against atherosclerosis may be dependent on the PON1 activities
17334638 Observational study of gene-disease association. (HuGE Navigator)
17309646 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17309646 The PON cluster appears to be a susceptibility locus for MI in Pakistani population, and the susceptibility is modulated through gene-gene and gene-environment interactions.
17304721 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17299970 Gene polymorphisms of PON1 55 Met/Leu, PON2 148 Ala/Gly and MnSOD 9 Ala/Val seemed to involve in the morbidity of CHD by influencing the plasma activities of PON and MnSOD.
17299970 Observational study of gene-disease association. (HuGE Navigator)
17296173 Serum PON1 activity is decreased in beta-thalassemia minor subjects and this low serum PON1 activity may lead to development of atherogenesis.
17286579 PON1 hydrolysis of soman is stereoselective.
17204329 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17204329 some PON1 promoter polymorphisms may predispose to sporadic amyotrophic lateral sclerosis
17183021 Observational study of gene-disease association. (HuGE Navigator)
17183021 Findings suggest that the association of PON1 Q192R with symptoms of depression in the occupationally exposed to toxins that everyone in the general population is exposed to rather than to toxins used by sheep dippers or Gulf War veterans
17173245 Observational study of gene-disease association. (HuGE Navigator)
17136774 This study represents the first formal statistical genetic test for G x S interactions on normal quantitative variation in PON1 activity in humans.
17125774 Lower serum paraoxonase-1 (PON1) activity seems to be related to decrease in HDL-C and, in part, to increased oxidative stress and inflammatory condition induced by H. pylori infection
17118352 another cause for the observed lower PON-1 concentrations in end-stage renal disease are the retention of low-middle molecules
17106515 purpose of this study was to explore the association between the activity of HDL-associated PON1 and circulating ox-LDL as well as to investigate the relationship between ox-LDL and parameters of lipid profile in thirty Slovaks
17090529 PON1 is neither a PLOOH peroxidase nor hydrolase and that the phospholipase A(2)-like activity previously attributed to PON1 in natural enzyme preparations was actually due to novel PLOOH hydrolytic activity of contaminating PAF-AH
17078098 Observational study of genotype prevalence. (HuGE Navigator)
17065348 In the control group, there was a significant negative correlation between serum PON1 activity and oxidized LDL concentration, but not in people with type 2 diabetes.
17001213 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16996683 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16985026 Observational study of gene-disease association. (HuGE Navigator)
16949520 Observational study of gene-disease association. (HuGE Navigator)
16949520 Genotyping of adolescents with diabetes for PON 1 polymorphisms was performed, including that of a novel PON 1 promoter polymorphism A(-1074)G. PON genotypes were related to diabetes complication status.
16949193 Observational study of gene-disease association. (HuGE Navigator)
16949193 No correlation was found between PON1 gene polymorphisms and preeclampsia.
16942773 paraoxonase-1 activity and concentration were influenced by HIV-infection and these were related to alterations in HDL composition and the immunological status
16940704 Observational study of gene-disease association. (HuGE Navigator)
16940704 as estimated by bradykinin and acetylcholine testing, findings suggest that paraoxonase-1 (PON1) genotypes may not play a critical role in the modulation of endothelial vasomotor function in the intact coronary circulation.
16926679 Observational study of gene-disease association. (HuGE Navigator)
16919539 cross-sectional study to correlate PON-1, homocysteine thiolactonase activities, and the lag time of LDL oxidation in control subjects and subjects with type 2 diabetes mellitus with different degrees of CVD
16915393 an increase in OP metabolites is associated with a high level of oxidative stress in OP sprayers, although the contribution of the PON1 polymorphism to the metabolism of OP is still unclear.
16914770 PON1 192R/Q polymorphs differ in HDL binding, lipolactonase stimulation, and cholesterol efflux
16912512 PON1 status and the levels of certain biochemical parameters are independently associated with the hypertension in hypertensive and obese hypertensive patients
16882531 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16880229 Observational study of gene-disease association. (HuGE Navigator)
16880229 In premenopausal women from the Spanish population, the PON1-108C/T polymorphism, and not polycystic ovary syndrome, is an important determinant of serum paraoxonase activity
16863614 Observational study of gene-disease association. (HuGE Navigator)
16835048 Observational study of gene-disease association. (HuGE Navigator)
16835048 Most of the newborn children and some pregnant women in this Latino cohort may have elevated susceptibility to organophosphate toxicity because of their PON1192 genotype and low PON1 plasma levels
16824336 Observational study of gene-disease association. (HuGE Navigator)
16822965 Observational study of gene-disease association. (HuGE Navigator)
16822965 the Q192R polymorphism was associated with sALS in recessive, additive, and dominant models.
16808888 Observational study of gene-disease association. (HuGE Navigator)
16807370 gene-environment interactions involving the ACHE/PON1 locus may be causally involved in determining the physiological response to organophosphate pesticide exposure.
16799134 Observational study of gene-disease association. (HuGE Navigator)
16799134 genetic variability at the PON1 locus is related to paraoxonase activity throughout life, and suggest that both parameters affect survival at extreme advanced age.
16794478 Observational study of gene-disease association. (HuGE Navigator)
16792468 In this study, PON1 activity was determined in healthy children aged 11 to 12 years and we found a similarity in PON1 activities of children and adults.
16790239 the decreased PON 1 activity, which were found in groups C and D post-delivery, may be due to the increased production of free radicals, during long-lasting labour + VG and obstructive labour + CS.
16780669 Observational study of gene-disease association. (HuGE Navigator)
16776637 There was a direct association between vitamin C intake and PON1 at week 32 (p=0.018)
16775186 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16775186 Single nucleotide polymorphism in paraoxonase 1 was associated with an increased risk of breast cancer
16767666 PON1 55 LM genotype and M allele, PON2 148 GG/AG genotype and G allele are the risk factors for coronary artery disease, and the activity of plasma PON is also markedly reduced in individuals with above genotypes.
16767666 Observational study of gene-disease association. (HuGE Navigator)
16766384 Observational study of gene-disease association. (HuGE Navigator)
16766384 Genetic variations are associated with risk factors, severity, type and prognosis of stroke and oxidative stress.
16729301 Observational study of gene-disease association. (HuGE Navigator)
16683402 Observational study of gene-disease association. (HuGE Navigator)
16681435 analysis of serum tHcy and PON1 levels in preschool aged children in Greece
16674912 Purified PON1 was exposed to phospholipids prior to the determination of arylesterase and paraoxonase activities.
16629699 Observational study of gene-disease association. (HuGE Navigator)
16627808 In this mouse model of metabolic syndrome, expressing human PON1 inhibited the development of atherosclerosis, probably by reducing the amount of oxidized LDL in plasma and in the plaque, thereby preventing its proatherogenic effects.
16614106 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16600468 A new purification strategy for human PON1 enzyme was developed using two-step procedures, namely ammonium sulfate precipitation and sepharose-4B-l-tyrosine-1-napthylamine hydrophobic interaction chromatography.
16565923 Observational study of gene-disease association. (HuGE Navigator)
16551349 Observational study of gene-disease association. (HuGE Navigator)
16534235 Our results suggest the role of other pathophysiological conditions besides hyperleptinemia resulting in decreased PON1 activity in hemodialysis patients.
16521945 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16515855 Observational study of gene-disease association. (HuGE Navigator)
16515855 Our data demonstrate that oxidative stress and neonatal birthweight are affected by maternal levels of Vitamins C and E in subjects with a PON polymorphism.
16510204 active role of PON1 in the regulation of oxidative stress, fibrosis and hepatic cell apoptosis in chronic liver diseases.
16495777 analysis of PON1 status in farmworker mothers and children
16474172 Previously undetected common functional PON1 polymorphisms that explain 4% of PON1 activity & a high rate of recombination in PON1, but the sum of common PON1 locus variation does not explain relationship between PON1 activity & carotid artery disease.
16472799 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16472799 Paraoxonase (PON1) 192R+ genotypes were associated with stroke and myocardial infarction, particularly in subsets of patients, in patterns suggesting a possible survivor effect.
16411107 Observational study of gene-disease association. (HuGE Navigator)
16411107 PON1 gene polymorphisms may influence the features of Japanese patients with primary open-angle glaucoma.
16407304 the catalytic histidine dyad of high density lipoprotein-associated serum paraoxonase-1 (PON1) is essential for PON1-mediated inhibition of low density lipoprotein oxidation and stimulation of macrophage cholesterol efflux
16387878 A haplotype of a PON1 gene significantly reduces the carrier's hazard of death over the follow-up.
16357806 Serum levels are lower in type 2 diabetes than in normal persons.
16327022 Observational study of gene-disease association. (HuGE Navigator)
16323636 Observational study of gene-disease association. (HuGE Navigator)
16319130 Observational study of gene-disease association. (HuGE Navigator)
16319130 Our results demonstrate association between Alzheimer disease and variants in the PON gene cluster in Caucasians and African Americans.
16308493 Observational study of gene-disease association. (HuGE Navigator)
16269825 Data demonstrate that human paraoxonase 1 expression is repressed by bile acids through the actions of FXR and FGF-19.
16260097 Although 3OC12-homoserine lactone production by P. aeruginosa was important for virulence in a mouse sepsis model, Pon1-knock-out mice were paradoxically protected.
16239632 Observational study of gene-disease association. (HuGE Navigator)
16239632 the Gln192Arg genotype of PON1 is an important risk factor for stroke
16229851 serum PON1 may have a role in atherosclerosis development in diabetic patients
16213467 Human plasma contains four esterases: butyrylcholinesterase, paraoxonase, acetylcholinesterase, and albumin.
16185677 Observational study of genetic testing. (HuGE Navigator)
16175651 Observational study of gene-disease association. (HuGE Navigator)
16175651 we suggest that the PON1 activities are affected by PON1 genetic variability in Turkish children with membranoproliferative glomerulonephritis.
16142697 Observational study of gene-disease association. (HuGE Navigator)
16142697 serum PON1 as a part of the lipid peroxidation scavenging systems might be involved in the tumourigenesis of brain tumours
16141008 Observational study of gene-disease association. (HuGE Navigator)
16140307 C-reactive protein concentration is significantly elevated in diseases associated with low levels of PON1, providing a mechanistic link between inflammation and the development of atherosclerosis.
16128586 affinity, stability, & lactonase activity of recombinant PON1 with reconsituted HDL were strongly correlated, with apoA-I exhibiting strongest effects, apoA-IV exhibiting weaker effects,& apoA-II having negative effect relative to protein-free particles.
16120573 Observational study of genotype prevalence. (HuGE Navigator)
16117861 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16112460 Overall, our findings suggest that protecting the esterolytic activity of PON1 by antioxidants might be important in preserving its action on phospholipid peroxides.
16112327 Individual differences in detoxication capacities for specific organophosphorous compounds are due largely to differences in catalytic efficiency or abundance of the HDL-associated enzyme, paraoxonase--REVIEW
16105444 Observational study of gene-disease association. (HuGE Navigator)
16094856 Observational study of gene-environment interaction. (HuGE Navigator)
16094856 results suggest that the Glnl92Arg polymorphism of the paraoxonase gene influences LDL size and susceptibility to oxidation in response to diet
16080611 Observational study of gene-disease association. (HuGE Navigator)
16078734 Observational study of gene-disease association. (HuGE Navigator)
16078734 Study has identified the PON1 -162G/A and R160G polymorphisms to be independently associated with coronary heart disease in Chinese Han population,and warrants further study to elucidate the biological mechanism.
16077191 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16077191 Determine associations between age, MTHFR/PON1 genotype and risk of coronary artery disease.
16052486 increased PON1 level may have a function related to the well-known atherosclerosis resistance of rats
16035730 Observational study of gene-disease association. (HuGE Navigator)
16035730 PON1-192Q allele, resulting in partly deficient antioxidant and detoxification activity of this enzyme, might be a risk factor for idiopathic chronic pancreatitis in Caucasians.
16030523 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16027737 linkage/association between autism and variants of the paraoxonase gene (PON1) encoding paraoxonase, the enzyme responsible for organophosphate detoxification
16023312 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16008163 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16002382 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15995178 Observational study of gene-disease association. (HuGE Navigator)
15993880 Observational study of genotype prevalence. (HuGE Navigator)
15993873 Observational study of gene-disease association. (HuGE Navigator)
15993873 paraoxonase-1 192 polymorphism contributes, together with other polymorphisms, to the variations in the host response to hepatitis C virus infection
15982977 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15974833 Observational study of gene-disease association. (HuGE Navigator)
15974833 We thus conclude that PON1 192 BB and PON1 55 LL alleles have protective effect against oxidative stress.
15969877 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15952113 Result exhibited an interaction of PON1 gene polymorphism A/B192 and ABCA1 genetic variation R219K on serum lipid level.
15952113 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15939049 PON1 directly reduced macrophage and aortic oxidative status associated with decreased superoxide anion production and increased glutathione. Could be responsible for attenuated atherosclerosis development in PON1Tg mice.
15928879 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15925115 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15925115 192 Q/R polymorphism of the PON-1 gene might influence responsiveness to cholinesterase inhibitors
15924216 Observational study of gene-disease association. (HuGE Navigator)
15922013 Observational study of gene-disease association. (HuGE Navigator)
15900219 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15899485 Human serum paraoxonase-1 (PON1) is thought to play a role in the favorable vascular effects of high-density lipoproteins, mainly through a reduction in low-density lipoprotein oxidation.
15877867 Observational study of gene-disease association. (HuGE Navigator)
15865106 Observational study of gene-disease association. (HuGE Navigator)
15864126 Observational study of gene-disease association. (HuGE Navigator)
15864126 Q and M alleles of PON1 have roles in susceptibility to toxicity from diazinon
15853807 Results suggest that, in wild-type HuPON1, H115 and F222 are important in determining substrate binding and specificity, but are not likely to be directly involved in substrate hydrolysis.
15853770 Observational study of gene-disease association. (HuGE Navigator)
15823275 postprandial chylomicrons contain PON1, which may function in the removal of atherogenic oxidized lipids
15797522 Observational study of gene-disease association. (HuGE Navigator)
15774926 Observational study of gene-disease association. (HuGE Navigator)
15772423 PON1, PON2, and PON3 are lactonases with overlapping and distinct substrate specificities
15767359 Observational study of gene-disease association. (HuGE Navigator)
15721005 PON1 was associated with VLDL in human serum, where triglycerides correlated independently with variations in serum mass and activity of the enzyme.
15715671 Observational study of gene-gene interaction. (HuGE Navigator)
15704252 human paraoxonase-1 (PON1) has homocysteine-thiolactonase activity
15681296 significant difference in the male genotype distribution of the CLA-1/SR-BI exon 8 (C8/T8) variant between groups and this significant risk was restricted to those subject carriers of Arg (R) and Leu (L) allele of the PON1
15654230 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15642273 Observational study of gene-disease association. (HuGE Navigator)
15642273 study of 187 patients with familial hypercholesterolemia shows genetic variation at the PON1 locus has a strong influence on PON1 activity as well as on carotid intima media thickness
15629887 findings suggest that inherited interactive weakness of acetylcholinesterase and paraoxonase 1 expression increases the insecticide-induced occurrence of Parkinson's disease
15580063 Observational study of gene-disease association. (HuGE Navigator)
15580063 The PON1 Leu-Met55 and Gln-Arg192 polymorphisms are not major risk factors for atherosclerosis in the general Caucasian population
15576850 Observational study of gene-disease association. (HuGE Navigator)
15576850 The Paraoxonase-1 can protect LDL and HDL against oxidative modification in vitro and therefore may protect against cardiovascular disease.
15538743 Observational study of gene-disease association. (HuGE Navigator)
15538743 cytochrome P-450c17alpha(CYP17), glutathione S-transferase pi(GSTP1), and paraoxonase (PON1)polymorphisms appear to be common genetic traits that are associated with an increased risk for prostate cancer
15488880 Observational study of gene-disease association. (HuGE Navigator)
15488805 Observational study of gene-disease association. (HuGE Navigator)
15488805 The M55L and Q192R SNPs of the PON1 gene do not appear to be associated with late AMD (age related mcaular degeneration) in individuals of Anglo-Celtic descent.
15454272 An independent risk factor for coronary disease (revieew)
15450851 The homology model presented here is very similar to the recently obtained PON1 crystal structure, and has allowed identification of several residues within the enzyme active site.
15368102 Meta-analysis of gene-disease association. (HuGE Navigator)
15359538 Observational study of genotype prevalence. (HuGE Navigator)
15346646 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15345661 Observational study of gene-disease association. (HuGE Navigator)
15331145 Observational study of gene-disease association. (HuGE Navigator)
15284530 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15284530 Amino Acid Substitution in paraoxonase-1 is associated with alcohol consumption and coronary atherosclerosis
15270786 Observational study of gene-disease association. (HuGE Navigator)
15256524 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15251338 Observational study of gene-disease association. (HuGE Navigator)
15251338 192 polymorphism of the PON1 gene is not associated with increased cardiovascular risk in renal transplant recipients.
15241482 Observational study of gene-disease association. (HuGE Navigator)
15236768 Observational study of gene-disease association. (HuGE Navigator)
15232408 Observational study of gene-disease association. (HuGE Navigator)
15232408 Genotyping for polymorphisms of PON1 Q192R, PON2 A148G, and PON2 S311C finds no association between mother's PON1 and PON2 genotypes and preterm delivery, but finds infant's PON1 RR and PON2 CC genotypes are associated with preterm delivery.
15214960 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
15166781 PON1 mass and activity in the plasma significantly influence the risk of developing cardiovascular disease [review].
15163466 Paraoxonase 1 has a role in regulating the level of HDL cholesterol
15140512 results suggest that an abnormal lipid profile and decreased PON and arylesterase activities may have a role in pathogenesis of preeclampsia
15136237 Observational study of gene-disease association. (HuGE Navigator)
15135268 Observational study of gene-disease association. (HuGE Navigator)
15124181 Observational study of gene-disease association. (HuGE Navigator)
15097870 Observational study of gene-disease association. (HuGE Navigator)
15090300 Observational study of gene-disease association. (HuGE Navigator)
15087255 Observational study of gene-disease association. (HuGE Navigator)
15076187 Observational study of gene-disease association. (HuGE Navigator)
15060281 Observational study of gene-disease association. (HuGE Navigator)
15050299 Observational study of gene-disease association. (HuGE Navigator)
15039125 Observational study of gene-disease association. (HuGE Navigator)
15023811 Observational study of gene-disease association. (HuGE Navigator)
15023811 findings suggest that the PON1 -107T allele is independently associated with the risk of arterial ischemic stroke, in addition to interacting with and potentiating the risk conferred by the Q192R polymorphism
15016430 Observational study of gene-disease association. (HuGE Navigator)
15016430 Two polymorphisms in PON1 are independent risk factors for non-Alzheimer's dementia: subjects at risk have lower plasma paraoxonase levels, and the enzyme is less active.
15015140 Increased oxidized LDL/apoB may result, at least partly, from reduced serum antioxidant capacity in the diabetic state, including the attenuation of paraoxonase 1 action
15008790 Observational study of genotype prevalence. (HuGE Navigator)
15008790 nucleotide variations and haplotypes of the promoter and 1.7-kb regions of PON1 showed population-specific patterns; discussed possible causes for the population differences in PON1 polymorphism in association with cardiovascular disease risk
15001326 Meta-analysis of gene-disease association. (HuGE Navigator)
14996478 Observational study of gene-disease association. (HuGE Navigator)
14985779 oxidative stress increase in WCH is associated with a decrease in PON1 activity. The reduction in PON1 activity may be one of the factors leading to an increase in oxidative status in white coat hypertension.
14967092 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14767577 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14767577 The -107T/C polymorphism as well as drinking and smoking were independently associated with plasma PON1 activity in healthy Chinese.
14695884 insights into the evolutionary relationships between different family members
14686479 Observational study of gene-disease association. (HuGE Navigator)
14669822 Increased LDL-cholesterol oxidation in thyroid dysfunction can be attributed to reduced paraoxonase 1 activity
14642415 paraoxonase 1 (PON1) activity in two completely CETP (cholesteryl ester transfer protein) deficient patients is caused by treatment with probucol, an antioxidative and hypolipidemic agent.
14642403 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14642403 The genetic variation of PON1 affects the formation of early atherosclerotic lesions and that the effect is modified by smoking.
14636952 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14636952 Human paraoxonase gene cluster polymorphisms is a predictor of coronary heart disease risk.
14624476 PON1 activity levels were decreased whereas serum malondialdehyde levels were increased in individuals exposed to radiation for a long period
14602783 greater degree of severity of the metabolic syndrome is associated with a progressively worse antioxidant/oxidant balance, which is consistent with increased oxidative stress and lower antioxidant PON1 enzymatic capacity.
14579940 Observational study of gene-disease association. (HuGE Navigator)
14527200 Observational study of genotype prevalence. (HuGE Navigator)
14511766 paraoxonase 1 mRNA expression by hepatocytes is regulated by proinflammatory cytokines and that proinflammatory cytokines secreted in a disease state may play a role in the development of atherosclerotic lesion
14500290 Simvastatin upregulated in a dose-dependent manner the activity of the promoter of the paraoxonase gene in expression cassettes transfected into HepG2 cells.
12963475 the high activity of PON1 towards 4-HDoHE and 5-HETE lactone suggests that oxidized eicosanoids and docosanoids may be important physiological substrates for PON1.
12957728 We propose that the elevation in TBARS levels might be a more marked indicator for the degree of atherosclerosis than the insufficiency in antioxidant enzymes such as SOD and PON1.
12955589 Observational study of gene-disease association. (HuGE Navigator)
12955589 Polymorphisms of paraoxonase 1 and 2 genes, alone or in combination is associated with with bone mineral density
12928148 Significant PON1 linkage disequilibrium was found among all three promoter polymorphisms and between L55M, with the strongest LD for Caucasians and the weakest for African Americans. The Caribbean Hispanics fall between these two groups.
12889841 Observational study of gene-disease association. (HuGE Navigator)
12871320 data collected in a cohort of 779 patients of whom 342 had developed restenosis indicate that the common variants for CETP and PON are not associated with incidence of restenosis after PTCA
12849920 Observational study of gene-disease association. (HuGE Navigator)
12849920 192 R allele of PON(1) gene is a risk factor for macrovascular disease of NIDDM in Chinese.
12824947 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
12824947 Polymorphism is associate with cerebral infarct in adult Japanese.
12805074 PON1 activity predicts carotid artery disease, yet 4 functional polymorphisms do not.
12790379 Observational study of gene-disease association. (HuGE Navigator)
12783936 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
12783936 The PON1 102V allele appears to be associated with an increased risk for prostate cancer.
12777966 PON1 levels plateau between 6 to 15 months of age, and that variability in the age at which PON1 levels plateau is quite variable among individuals
12756158 Low serum PON1 activity toward paraoxon is an independent risk factor for coronary events in men at high risk because of preexisting disease or other CHD risk factors
12740482 Observational study of gene-disease association. (HuGE Navigator)
12740482 The PON1 genotype clearly determined the oxidative modification of lipoproteins and may play a role in the pathogenesis of atherosclerosis via its protective effect against lipoprotein oxidation in Japanese subjects.
12706315 Observational study of gene-disease association. (HuGE Navigator)
12706315 reported that oxidative stress attenuates insulin signaling in vitro. The PON1 promoter polymorphism C(-108)T may influence insulin sensitivity by modulating serum antioxidant capacity.
12697270 in age- and gender-matched subgroups of rheumatoid arthritis and healthy subjects serum paraoxonase activity was found to be significantly decreased
12679462 data suggest that paraoxonase-1 activity loss is an event occurring later in the course of diabetes mellitus and it does not affect oxidation of circulating LDL
12645966 polymorphisms in the paraoxonase (PON1) gene have been described, which have been shown to affect either the catalytic efficiency of hydrolysis or the expression level of PON1--review
12640090 Observational study of gene-disease association. (HuGE Navigator)
12625227 Observational study of gene-disease association. (HuGE Navigator)
12621166 Observational study of gene-disease association. (HuGE Navigator)
12621166 PON R192Q polymorphism could affect HDL-C levels after caloric restriction in nondiabetic healthy males presumably due to decreased HL activity and altered insulin resistance.
12618290 Observational study of gene-disease association. (HuGE Navigator)
12618279 Observational study of gene-disease association. (HuGE Navigator)
12618279 Paraoxonase 1 gene polymorhism appears to be an independent risk factor for carotid intima thickness in middle-aged women.
12615663 PON1 inhibits macrophage cholesterol biosynthesis and atherogenesis probably through its phospholipase-A2-like activity.
12601623 effect of homocysteinylation on high-density lipoprotein-paronoxase activity
12588779 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12588779 An extensive association study has identified the PON1 R160G and -162G/A polymorphisms to be independently associated with coronary heart disease in a Chinese Han population.
12575193 Observational study of gene-disease association. (HuGE Navigator)
12566597 Observational study of gene-disease association. (HuGE Navigator)
12563177 Observational study of gene-disease association. (HuGE Navigator)
12563177 The polymorphism of the paraoxonase gene may not be involved in the susceptibility to organophosphorus poisoning in farmers dipping sheep
12545199 biosynthesis of PON1 in human serum stimulated by Cl- and activity of the protein in the presence of other halides.
12536571 Observational study of gene-disease association. (HuGE Navigator)
12531885 paraoxonase-associated high density lipoproteins bind to ghrelin and has a role in lipid transport and metabolism
12480756 Observational study of gene-disease association. (HuGE Navigator)
12480756 polymorphic in Alzheimer's disease
12480737 a possible marker of vascular dementia
12474066 Clinical trial of gene-disease association. (HuGE Navigator)
12466264 determination that paraoxonase 1 has no phospholipase activity toward PAF or pro-atherogenic oxidized phospholipids
12454802 Observational study of gene-disease association. (HuGE Navigator)
12454802 Association between the severity of angiographic coronary artery disease and paraoxonase gene polymorphisms in the National Heart, Lung, and Blood Institute-sponsored Women's Ischemia Syndrome Evaluation (WISE) study
12442067 Observational study of gene-disease association. (HuGE Navigator)
12442067 serum activity and gene polymorphism in type 2 diabetic patients with or without vascular complications
12417809 Observational study of gene-disease association. (HuGE Navigator)
12355548 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12241013 Observational study of gene-disease association. (HuGE Navigator)
12241013 The association between the PON1 codon 192 polymorphism and fasting concentrations of glucose, lipids, lipoproteins and PON1 activity greater for postmenopausal women.
12210872 Observational study of gene-disease association. (HuGE Navigator)
12204800 Observational study of gene-disease association. (HuGE Navigator)
12204800 Elevated blood HDL cholesterol level is significantly associated with the arginine variant in position 192 of the PON1 gene.
12204423 Observational study of gene-disease association. (HuGE Navigator)
12204423 HDL3-related decreased serum paraoxonase (PON) activity in uremic patients: comparison with the PON1 allele polymorphism
12196500 Observational study of gene-disease association. (HuGE Navigator)
12151850 REVIEW: The paraoxonase gene family and coronary heart disease
12139735 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12082592 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12082503 Observational study of gene-disease association. (HuGE Navigator)
12082503 genetic variability at PON1 locus affects survival at extreme advanced age
12080042 characterization of oligomeric states of detergent-solubilized PON1
12074828 Observational study of gene-disease association. (HuGE Navigator)
12074828 There is a minor association between BChE-K and early-onset coronary artery disease, especially in the presence of the APOE-epsilon 4 allele
12074827 Observational study of gene-disease association. (HuGE Navigator)
12074827 Paraoxonase Gln-Arg(192) and Leu-Met(55) gene polymorphisms and enzyme activity in a population with a low rate of coronary heart disease
12052975 Observational study of gene-disease association. (HuGE Navigator)
12052142 PON1 status (C-108T promoter polymorphism) is useful for identifying individuals at risk for cardiovascular disease
12009854 Observational study of genotype prevalence. (HuGE Navigator)
11993715 Plasma as well as HDL paraoxonase activity decreased significantly with aging (r =-0.218, P < 0.039) and (r = -0.280, P < 0.006) respectively
11971942 Observational study of gene-environment interaction. (HuGE Navigator)
11971942 results suggest that the effects of regular and acute exercise on PON1 activity levels are modulated by PON1-192 polymorphism
11940319 effect of paraoxonase-1 (PON-1) and oxidized low density lipoprotein (ox-LDL) in diabetic nephropathy (DN)
11935033 Observational study of gene-disease association. (HuGE Navigator)
11918623 Observational study of gene-disease association. (HuGE Navigator)
11918623 diabetic microangiopathy is genetically heterogeneous; PON1 Leu/Leu increases the risk for retinopathy and PON2 Ser/Ser increases the risk for microalbuminuria
11918278 Antioxidant enzymes and paraoxonase show a co-activity in preserving low-density lipoprotein from oxidation.
11889198 Observational study of gene-disease association. (HuGE Navigator)
11889198 Paraoxonase-1 L55M polymorphism is associated with an abnormal oral glucose tolerance test and differentiates high risk coronary disease families.
11888590 Observational study of gene-disease association. (HuGE Navigator)
11888532 Observational study of gene-disease association. (HuGE Navigator)
11880198 Observational study of gene-disease association. (HuGE Navigator)
11880198 The Gln192Arg polymorphism of the paraoxonase-1 gene may not be involved in the susceptibility to schizophrenia.
11860890 Observational study of genotype prevalence. (HuGE Navigator)
11851721 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11810302 Observational study of gene-disease association. (HuGE Navigator)
11810302 PON1-192R allele may play an important role in the genesis of coronary spasm, probably by attenuating the suppression of oxidative stress.
11788650 Observational study of gene-disease association. (HuGE Navigator)
11768721 Observational study of gene-disease association. (HuGE Navigator)
11768721 association between left ventricular hypertrophy and the C825T allele of the G-protein beta3 subunit gene in Arabs. (G PROTEIN BETA3)
11740946 Observational study of gene-environment interaction. (HuGE Navigator)
11714857 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11692002 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11676977 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11676977 study suggested a gene-gene interaction between the PON1 and PON2 polymorphisms for CAD risk; may have linkage disequilibrium with a tightly linked PON3 locus or significant atherosclerotic alleles of nearby genes
11668222 Clinical trial of gene-environment interaction. (HuGE Navigator)
11596674 Observational study of gene-disease association. (HuGE Navigator)
11557671 Observational study of gene-disease association. (HuGE Navigator)
11555845 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11512679 Observational study of genotype prevalence. (HuGE Navigator)
11511976 Observational study of gene-disease association. (HuGE Navigator)
11511975 Observational study of gene-disease association. (HuGE Navigator)
11476678 Observational study of gene-disease association. (HuGE Navigator)
11472729 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11428219 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11409295 Observational study of gene-disease association. (HuGE Navigator)
11395042 Observational study of gene-disease association. (HuGE Navigator)
11388660 Observational study of gene-disease association. (HuGE Navigator)
11375798 Observational study of gene-disease association. (HuGE Navigator)
11341749 Observational study of genotype prevalence. (HuGE Navigator)
11328206 Observational study of gene-disease association. (HuGE Navigator)
11257264 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11239953 Observational study of gene-disease association. (HuGE Navigator)
11238489 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11231922 Observational study of gene-disease association. (HuGE Navigator)
11151764 Observational study of gene-disease association. (HuGE Navigator)
11104219 Observational study of gene-disease association. (HuGE Navigator)
11096050 Observational study of gene-disease association. (HuGE Navigator)
11073850 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAKLIALTLLGMGLALFRNHQSSYQTRLNALREVQPVELPNCNLVKGIETGSEDLEILPNGLAFISSGLK      1 - 70
YPGIKSFNPNSPGKILLMDLNEEDPTVLELGITGSKFDVSSFNPHGISTFTDEDNAMYLLVVNHPDAKST     71 - 140
VELFKFQEEEKSLLHLKTIRHKLLPNLNDIVAVGPEHFYGTNDHYFLDPYLQSWEMYLGLAWSYVVYYSP    141 - 210
SEVRVVAEGFDFANGINISPDGKYVYIAELLAHKIHVYEKHANWTLTPLKSLDFNTLVDNISVDPETGDL    211 - 280
WVGCHPNGMKIFFYDSENPPASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKA    281 - 350
LYCEL                                                                     351 - 355
//

Text Mined References (979)

PMID Year Title
27166546 2016 Q192R paraoxonase1 polymorphism is a risk factor for cataract in Pakistani population.
27085770 2016 Systematic review and meta-analysis deciphering the impact of fibrates on paraoxonase-1 status.
26870959 2016 Association of PON1, P2Y12 and COX1 with Recurrent Ischemic Events in Patients with Extracranial or Intracranial Stenting.
26829396 2016 Toward Understanding the Catalytic Mechanism of Human Paraoxonase 1: Site-Specific Mutagenesis at Position 192.
26773776 2016 The effect of the paraoxonase 1 (PON1) T(-107)C polymorphism on serum PON1 activity in women is dependent on fatty acid intake.
26769660 2016 Association between alcohol consumption and serum paraoxonase and arylesterase activities: a cross-sectional study within the Bavarian population.
26654051 2016 Inhibition of quorum sensing-controlled virulence factors in Pseudomonas aeruginosa by human serum paraoxonase.
26632904 2015 Association of Paraoxonase 1 Gene Polymorphisms With the Risk of Hepatitis B Virus-related Liver Diseases in a Guangxi Population: A Case-control Study.
26567339 2016 Identification of Critical Paraoxonase 1 Residues Involved in High Density Lipoprotein Interaction.
26254371 2015 Q192R and L55M Polymorphisms of Paraoxonase 1 Gene in Chronic Myelogenous Leukemia and Chronic Lymphocytic Leukemia.
26251874 2015 Oxidative stress biomarkers and paraoxonase 1 polymorphism frequency in farmers occupationally exposed to pesticides.
26241956 2015 Association between Paraoxonase 1 (PON1) Polymorphisms and the Risk of Acute Coronary Syndrome in a North African Population.
26227792 2015 Association Between Paraoxonase Gene Polymorphisms and Intracerebral Hemorrhage in a Korean Population.
26193203 2015 Paraoxonase 1 genotype-phenotype correlation in patients with metabolic syndrome.
26178739 2015 Serum paraoxonase and arylesterase activities of paraoxonase-1 (PON-1), mild cognitive impairment, and 2-year conversion to dementia: A pilot study.
26154629 2015 The Paraoxonase 1 Gene c.-108C>T SNP in the Promoter Is Associated with Risk for Glioma in Mexican Patients, but Not the p.L55M or p.Q192R Polymorphisms in the Coding Region.
26103614 2015 How HDL protects LDL against atherogenic modification: paraoxonase 1 and other dramatis personae.
26091975 2015 Paraoxonase-1 and oxidized lipoprotein lipids. The Cardiovascular Risk in Young Finns Study.
26039660 2015 p.Q192R SNP of PON1 seems not to be Associated with Carotid Atherosclerosis Risk Factors in an Asymptomatic and Normolipidemic Brazilian Population Sample.
26028114 2015 Paraoxonase 1 (PON1) Q192R Gene Polymorphism and Cancer Risk: A Meta-Analysis Based on 30 Publications.
26025407 2015 The association of PON1 192 Q/R polymorphism and the risk of female infertility.
26016451 2015 Oxidative stress and paraoxonase 1 status in acute ischemic stroke patients.
26009633 2015 PLTP activity inversely correlates with CAAD: effects of PON1 enzyme activity and genetic variants on PLTP activity.
25991559 2015 Oxidative stress-related genes in type 2 diabetes: association analysis and their clinical impact.
25968808 2015 Serum paraoxonase and arylesterase activities in patients with chronic otitis media.
25966589 2015 [Association of (192) Q>R polymorphism of the paraoxonase gene with a lipid profile and components of lipid peroxidation and antioxidant protection in populations of Russians and Buryats from Eastern Siberia].
25965560 2015 Human paraoxonase-1 (PON1): Gene structure and expression, promiscuous activities and multiple physiological roles.
25964115 2015 Association of elevated apoA-I glycation and reduced HDL-associated paraoxonase1, 3 activity, and their interaction with angiographic severity of coronary artery disease in patients with type 2 diabetes mellitus.
25962362 2016 Paraoxonase (PON1) polymorphisms Q192R and L55M are not associated with human longevity: A meta-analysis.
25956367 2015 PON1 polymorphisms are associated with polycystic ovary syndrome susceptibility, related traits, and PON1 activity in Indian women with the syndrome.
25953737 Paraoxonase activity as a marker of exposure to xenobiotics in tobacco smoke.
25935173 2015 Genetic polymorphisms in paraoxonase 1 and G protein-coupled receptor 77, and the risk of glucose-6-phosphate dehydrogenase deficiency in a Saudi population.
25880731 2015 Association between genetic polymorphisms and carotid atherosclerosis in patients treated with radiotherapy for nasopharyngeal carcinoma.
25835425 2015 Genetics of Vascular Dementia: Systematic Review and Meta-Analysis.
25814092 2015 Paraoxonase-1 enzyme activity assay for clinical samples: validation and correlation studies.
25801214 2015 Low protective PON1 lactonase activity in an Arab population with high rates of coronary heart disease and diabetes.
25746376 2015 Interaction effects between Paraoxonase 1 variants and cigarette smoking on risk of coronary heart disease in a Singaporean Chinese population.
25741997 2015 Interactions between paraoxonase 1 genetic polymorphisms and smoking and their effects on oxidative stress and lung cancer risk in a Korean population.
25734763 2015 Determination of the genotype and phenotype of serum paraoxonase 1 (PON1) status in a group of agricultural and nonagricultural workers in the Coquimbo Region, Chile.
25723374 2015 Paraoxonase and arylesterase activities in patients with papillary thyroid cancer.
25684529 2015 Association of paraoxonase-1(Q192R and L55M) gene polymorphisms and activity with colorectal cancer and effect of surgical intervention.
25668223 2015 Altered lipid subfraction profile and impaired antioxidant defense of high-density lipoprotein in Smith-Lemli-Opitz syndrome.
25600537 Evaluation of paraoxonase 1 polymorphisms in patients with bipolar disorder.
25600530 Paraoxonase1 192 (PON1 192) gene polymorphism and serum paraoxonase activity in panic disorder patients.
25575948 2015 Lactonase activity and status of paraoxonase 1 in Chinese women with polycystic ovarian syndrome.
25530140 2015 Paraoxonase 1 phenotype and paraoxonase activity in asthmatic patients.
25520116 2014 Decreased HDL-dependent paraoxonase and arylesterase enzyme activity may indicate a worse prognosis in multiple myeloma.
25510689 2014 Serum arylesterase and paraoxonase activities in patients with ovarian tumors.
25500007 2015 Q192R polymorphism of paraoxonase 1 gene associated with insulin resistance in Mexican children.
25490030 2015 PON-1 and ferroxidase activities in older patients with mild cognitive impairment, late onset Alzheimer's disease or vascular dementia.
25464671 Study on paraoxonase 1 in type 2 diabetes mellitus.
25463530 2015 Interaction between paraoxonase 1 polymorphism and prenatal pesticide exposure on metabolic markers in children using a multiplex approach.
25459919 Paraoxonase 1 activity and level of antibodies directed against oxidized low density lipoproteins in a group of an elderly population in Poland - PolSenior study.
25445355 2015 Association of paraoxonase (PON)1 activity, glutathione S-transferase GST T1/M1 and STin.2 polymorphisms with comorbidity of tobacco use disorder and mood disorders.
25420483 2014 Low paraoxonase 1 arylesterase activity and high von Willebrand factor levels are associated with severe coronary atherosclerosis in patients with non-diabetic stable coronary artery disease.
25406539 2014 Anti-cyclic citrullinated peptide antibodies and paraoxonase-1 polymorphism in rheumatoid arthritis.
25386619 2014 Human paraoxonase 1 as a pharmacologic agent: limitations and perspectives.
25367762 2015 Influence of oak wood polyphenols on cysteine, homocysteine and glutathione total levels and PON1 activities in human adult volunteers - a pilot study.
25304213 2015 Novel nucleophiles enhance the human serum paraoxonase 1 (PON1)-mediated detoxication of organophosphates.
25301263 2015 Paraoxonase 1 Q192R and L55M polymorphisms and susceptibility to amyotrophic lateral sclerosis: a meta-analysis.
25297118 2015 Significant interethnic differencies in functional variants of PON1 and P2RY12 genes in Roma and Hungarian population samples.
25264968 2014 Genotype and phenotype frequencies of paraoxonase 1 in fertile and infertile men.
25261854 2015 Paraoxonase 1 and HDL maturation.
25241610 2014 Serum paraoxonase/arylesterase activity and oxidative stress status in children with metabolic syndrome.
25218815 2014 Alteration of HDL functionality and PON1 activities in acute coronary syndrome patients.
25180809 2014 Exploring the aryl esterase catalysis of paraoxonase-1 through solvent kinetic isotope effects and phosphonate-based isosteric analogues of the tetrahedral reaction intermediate.
25179377 2015 Association between butyrylcholinesterase activity and phenotypes, paraoxonase192 rs662 gene polymorphism and their enzymatic activity with severity of rheumatoid arthritis: correlation with systemic inflammatory markers and oxidative stress, preliminary report.
25155309 2016 The influence of renal function on the association of rs854560 polymorphism of paraoxonase 1 gene with long-term prognosis in patients after myocardial infarction.
25093614 2014 Human paraoxonase 1 hydrolysis of nanomolar chlorpyrifos-oxon concentrations is unaffected by phenotype or Q192R genotype.
25070982 2014 Repeated gestational exposure of mice to chlorpyrifos oxon is associated with paraoxonase 1 (PON1) modulated effects in maternal and fetal tissues.
25038995 2014 Systemic inflammation, intestine, and paraoxonase-1.
25038992 2014 Inflammation, infection, cancer and all that…the role of paraoxonases.
25037113 2014 Paraoxonase (PON)1 Q192R functional genotypes and PON1 Q192R genotype by smoking interactions are risk factors for the metabolic syndrome, but not overweight or obesity.
25036896 2014 Relationship between the paraoxonase 1 gene glutamine 192 to arginine polymorphism and gestational diabetes mellitus in Saudi women.
25027835 2014 Paraoxonase 1 polymorphisms within a Mississippi USA population as possible biomarkers of enzyme activities associated with disease susceptibility.
24988089 2014 Paraoxonase, oxidized low density lipoprotein, monocyte chemoattractant protein-1 and adhesion molecules are associated with macrovascular complications in patients with type 2 diabetes mellitus.
24972570 2014 PON1 Q192R polymorphism (rs662) is associated with childhood embryonal tumors.
24965284 2014 Synergistic epistasis of paraoxonase 1 (rs662 and rs85460) and apolipoprotein E4 genes in pathogenesis of Alzheimer's disease and vascular dementia.
24936519 2014 The relation of PON1-L55M gene polymorphism and clinical manifestation of Behcet's disease.
24920129 2014 Antioxidant status in blood of obese children: the relation between trace elements, paraoxonase, and arylesterase values.
24918121 2014 Association between PON1 rs662 polymorphism and coronary artery disease.
24841661 2014 Genetic polymorphisms of paraoxonase1 192 and glutathione peroxidase1 197 enzymes in familial Mediterranean fever.
24834831 2014 Paraoxonase I polymorphisms and attention/hyperactivity in school-age children from Mexico City, Mexico.
24833785 2014 Investigation of a PON1 gene polymorphism (rs662 polymorphism) as predictor of subclinical atherosclerosis in patients with rheumatoid arthritis.
24831724 2014 Paraoxonase 1 activity in patients with chronic obstructive pulmonary disease.
24830418 2015 Oxidative stress and paraoxonase 1 activity predict contrast-induced nephropathy in patients with ST-segment elevation myocardial infarction undergoing primary percutaneous coronary intervention.
24826966 2014 Purification of paraoxonase enzyme from the sera of patients with Behcet's disease and analyzing the effects of the drugs containing imuran (azathioprine), prednisolone (methylprednisolone) and colchium (colchicine).
24813034 2014 Paraoxonase 1 activity and lipid profile in schizophrenic patients.
24793345 Can paraoxonase 1 polymorphisms (L55 M and Q192 R) protect children with type 1 diabetes against lipid abnormalities?
24769273 2014 Serum paraoxonase-1 activity is more closely related to HDL particle concentration and large HDL particles than to HDL cholesterol in Type 2 diabetic and non-diabetic subjects.
24763406 2014 Paraoxonase-1 activity and oxidative stress in patients with anterior ST elevation myocardial infarction undergoing primary percutaneous coronary intervention with and without no-reflow.
24731121 2014 Serum paraoxonase-1 enzyme activities and oxidative stress levels in patients with esophageal squamous cell carcinoma.
24721823 2014 Prognostic value of paraoxonase 1 in patients undergoing coronary artery bypass grafting surgery.
24719500 2014 Human paraoxonase-1 activity is related to the number of CD4+ T-cells and is restored by antiretroviral therapy in HIV-1-infected individuals.
24706428 2014 Serum paraoxonase activity and oxidative stress and their relationship with obesity-related metabolic syndrome and non-alcoholic fatty liver disease in obese children and adolescents.
24704632 2014 Serum myeloperoxidase/paraoxonase 1 ratio as potential indicator of dysfunctional high-density lipoprotein and risk stratification in coronary artery disease.
24700021 2014 Paraoxonase (PON1) activity in patients with subclinical thoracic aortic atherosclerosis.
24682159 2014 Association of cadmium, lead and mercury with paraoxonase 1 activity in women.
24679385 2014 Lowered plasma paraoxonase (PON)1 activity is a trait marker of major depression and PON1 Q192R gene polymorphism-smoking interactions differentially predict the odds of major depression and bipolar disorder.
24665146 2014 Low paraoxonase 1 activity predicts mortality in surgical patients with sepsis.
24620935 2014 Paraoxonase 1 lactonase activity and distribution in the HDL subclasses in the cord blood.
24524596 2014 Evidence for the presence of active paraoxonase 1 in small-dense low-density lipoprotein.
24504666 2014 Positive clinical response to clopidogrel is independent of paraoxonase 1 Q192R and CYP2C19 genetic variants.
24501102 2014 Acetaminophen intoxication is associated with decreased serum paraoxonase and arylesterase activities and increased lipid hydroperoxide levels.
24500802 2014 Epigenetic patterns of two gene promoters (TNF-? and PON) in stroke considering obesity condition and dietary intake.
24477584 2014 Genetic association of IDE, POU2F1, PON1, IL1? and IL1? with type 2 diabetes in Pakistani population.
24473115 2014 Arylesterase phenotype-specific positive association between arylesterase activity and cholinesterase specific activity in human serum.
24456870 2014 Paraoxonase 1 (PON1) genotype associated with heart rate variability (HRV) in workers.
24448003 2014 Methylmercury exposure, PON1 gene variants and serum paraoxonase activity in Eastern James Bay Cree adults.
24440837 2014 The correlation of the total antioxidant status (TAS), total oxidant status (TOS) and paraoxonase activity (PON1) with smoking.
24423117 2014 A randomised controlled trial of increasing fruit and vegetable intake and how this influences the carotenoid concentration and activities of PON-1 and LCAT in HDL from subjects with type 2 diabetes.
24399815 2014 Synergistic effects of BuChE non-UU phenotype and paraoxonase (PON1) 55 M allele on the risk of systemic lupus erythematosus: influence on lipid and lipoprotein metabolism and oxidative stress, preliminary report.
24384301 2014 Activation of paraoxonase 1 after hemodialysis is associated with HDL remodeling and its increase in the HDL2 fraction and VLDL.
24364225 Genetic polymorphisms of paraoxonase 1 and susceptibility to atherogenesis.
24314997 2013 Relationship between serum paraoxonase and homocysteine thiolactonase activity, adipokines, and asymmetric dimethyl arginine concentrations in renal transplant patients.
24301778 2013 Association of paraoxonase polymorphisms with carotid artery atherosclerosis in essential hypertension patients.
24280342 2014 Activation of paraoxonase 1 is associated with HDL remodeling ex vivo.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24267244 2013 Gender-specific correlation between plasma myeloperoxidase levels and serum high-density lipoprotein-associated paraoxonase-1 levels in patients with stable and unstable coronary artery disease.
24229619 2013 Oral squamous cell carcinoma and serum paraoxonase 1.
24228251 2013 Paired measurements of paraoxonase 1 and serum amyloid A as useful disease markers.
24211756 2013 Metabolic syndrome in children with chronic kidney disease: PON1 and treatment modality.
24206655 2013 Association of a polymorphism in PON-1 gene with steroid-induced osteonecrosis of femoral head in Chinese Han population.
24200861 2014 Lack of ligand-selective binding of the aryl hydrocarbon receptor to putative DNA binding sites regulating expression of Bax and paraoxonase 1 genes.
24186356 2014 Serum paraoxonase and arylesterase activities and oxidative stress levels in patients with SSRI intoxication.
24170778 2014 Multiple cytochrome P450 isoforms are involved in the generation of a pharmacologically active thiol metabolite, whereas paraoxonase 1 and carboxylesterase 1 catalyze the formation of a thiol metabolite isomer from ticlopidine.
24167353 2013 Reduced paraoxonase 1 activity as a marker for severe coronary artery disease.
24148525 2014 Assessment of early atherosclerotic findings in patients with nasal polyposis.
24147648 2014 Leptin and paraoxonase activity in cord blood from obese mothers.
24130171 2014 Global DNA methylation and one-carbon metabolism gene polymorphisms and the risk of breast cancer in the Sister Study.
24123308 2013 Characterization of human paraoxonase 1 variants suggest that His residues at 115 and 134 positions are not always needed for the lactonase/arylesterase activities of the enzyme.
24100645 2013 Association of paraoxonase gene polymorphisms with diabetic nephropathy and retinopathy.
24080149 2013 Paraoxonase-1 activity affects the clopidogrel response in CYP2C19 loss-of-function carriers.
24057998 2013 Household organophosphorus pesticide use and Parkinson's disease.
24057271 2013 Investigation of the common paraoxonase 1 variants with paraoxonase activity on bone fragility in Turkish patients.
24028901 2013 Impaired paraoxonase-1 status in obese children. Relationships with insulin resistance and metabolic syndrome.
24028323 2014 Paraoxonase 1 and oxidative stress in paediatric non-alcoholic steatohepatitis.
24024900 2013 Pharmacogenetics of paraoxonase activity: elucidating the role of high-density lipoprotein in disease.
23993903 2013 PON1 Q192R genotype influences clopidogrel responsiveness by relative platelet inhibition instead of on-treatment platelet reactivity.
23936524 2013 Genome-wide linkage analysis of cardiovascular disease biomarkers in a large, multigenerational family.
23917967 2013 Association of paraoxonase 1 gene polymorphism and enzyme activity with carotid plaque in rheumatoid arthritis.
23908111 2013 Myeloperoxidase, paraoxonase-1, and HDL form a functional ternary complex.
23893804 2013 Paraoxonase (PON1) 55 polymorphism and association with systemic lupus erythematosus.
23884836 2013 Association of serum paraoxonase activity and coronary artery calcification.
23865359 2013 Decreased paraoxonase 1, arylesterase enzyme activity, and enhanced oxidative stress in patients with mitral and aortic valve insufficiency.
23850044 2014 [Relevance of CYP2C19 2 regarding platelet reactivity in patients with acute coronary syndrome treated with clopidogrel].
23834345 2013 Assessment of the serum paraoxonase activity and oxidant/antioxidant status in patients with recurrent aphthous stomatitis.
23821382 2013 Paraoxonase 1 (PON1) gene-108C>T and p.Q192R polymorphisms and arylesterase activity of the enzyme in patients with dementia.
23791833 2013 Interleukin-6 upregulates paraoxonase 1 gene expression via an AKT/NF-?B-dependent pathway.
23789921 2013 Paraoxonase 1 activities and genetic variation in childhood obesity.
23768700 2013 Enhanced HDL-cholesterol-associated anti-oxidant PON-1 activity in prostate cancer patients.
23742759 2013 Associations between genetic polymorphisms of paraoxonase genes and coronary artery disease in a Taiwanese population.
23710701 2013 Effect of exercise on plasma paraoxonase1 activity in rugby players: dependance on training experience.
23709379 Paraoxonase (PON)-1 activity in overweight and obese children and adolescents: association with obesity-related inflammation and oxidative stress.
23706841 2013 Reduced PON1 enzymatic activity and increased lipid hydroperoxide levels that point out oxidative stress in generalized anxiety disorder.
23688862 2013 Pesticide exposure and genetic variation in xenobiotic-metabolizing enzymes interact to induce biochemical liver damage.
23680251 Paraoxonase 1: a better atherosclerotic risk predictor than HDL in type 2 diabetes mellitus.
23672526 2013 Assessing the relationship of paraoxonase-1 Q192R polymorphisms and the severity of lung disease in SM-exposed patients.
23669169 2013 Serum paraoxonase and arylesterase activity and oxidative status in patients with multiple sclerosis.
23658746 2013 Associations of PON1 and genetic ancestry with obesity in early childhood.
23651475 2013 Polymorphisms in xenobiotic metabolizing genes (EPHX1, NQO1 and PON1) in lymphoma susceptibility: a case control study.
23637274 2013 Prognostic value of serum paraoxonase and arylesterase activity in patients with sepsis.
23628180 2013 PON1 gene polymorphisms and plasma PON1 activities in Takayasu's arteritis disease.
23625910 2015 Effect of paraoxonase 1 192 Q/R polymorphism on paraoxonase and acetylcholinesterase enzyme activities in a Turkish population exposed to organophosphate.
23625196 2013 The Q192R polymorphism of the paraoxonase 1 gene is a risk factor for coronary artery disease in Saudi subjects.
23608957 2013 Association of PON1 genotype and haplotype with susceptibility to coronary artery disease and clinical outcomes in dual antiplatelet-treated Han Chinese patients.
23606795 2013 Levels of oxidized LDL, estrogens, and progesterone in placenta tissues and serum paraoxonase activity in preeclampsia.
23602893 2013 Functional paraoxonase 1 variants modify the risk of Parkinson's disease due to organophosphate exposure.
23590198 2013 PON1 Q192R and L55M polymorphisms and organophosphate toxicity risk: a meta-analysis.
23582715 2013 Paraoxonase 1 (PON1) reduces macrophage inflammatory responses.
23557751 2013 Diminished antioxidant activity of high-density lipoprotein-associated proteins in chronic kidney disease.
23551806 2013 Total oxidant, antioxidant, and paraoxonase levels in babies born to pre-eclamptic mothers.
23547806 2013 The associations between serum paraoxonase 1 activity and carotid atherosclerosis in renal transplant patients.
23538572 2013 Association of paraoxonase 1 L55M and Q192R single-nucleotide polymorphisms with age-related macular degeneration.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23508039 2013 Paraoxonase 1 activities, regulation, and interactions with atherosclerotic lesion.
23497787 2013 A functional polymorphism of PON1 interferes with microRNA binding to increase the risk of ischemic stroke and carotid atherosclerosis.
23487294 Polymorphisms of paraoxonase 1 and 2 genes and the risk of multiple sclerosis in the Polish population.
23471031 2013 Paraoxonase-1 status in patients with hereditary hemochromatosis.
23442176 2013 Quantitative proteomic analysis identified paraoxonase 1 as a novel serum biomarker for microvascular invasion in hepatocellular carcinoma.
23441349 2012 Paraoxonase 1 status in keratoconus: a preliminary study of activity and polymorphism.
23441121 2013 Protective effect of paraoxonase 1 gene variant L55M in retinal vein occlusion.
23438848 2012 Paraoxonase-1 (PON1) status in pancreatic cancer: relation to clinical parameters.
23435062 2013 Association between PON1 genetic polymorphisms and miscarriage in Mexican women exposed to pesticides.
23426541 2013 Paraoxonase 1 and arylesterase levels in children with familial Mediterranean fever.
23418418 2013 Paraoxonase 1 gene polymorphism does not affect clopidogrel response variability but is associated with clinical outcome after PCI.
23406590 2013 Plasma paraoxonase activity and oxidative stress and their relationship to disease severity in children with allergic rhinitis.
23391848 2013 OLR1, PON1 and MTHFR gene polymorphisms, conventional risk factors and the severity of coronary atherosclerosis in a Chinese Han population.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23370296 2013 Effects of paraoxonase 1 activity and gene polymorphisms on long-term pulmonary complications of sulfur mustard-exposed veterans.
23356507 2013 Association between paraoxonase gene and stroke in the Han Chinese population.
23346768 2012 Paraoxonase-1 Q192R polymorphism is not associated with clopidogrel response in Chinese stroke patients.
23316782 2013 Monocyte-macrophage membrane possesses free radicals scavenging activity: stimulation by polyphenols or by paraoxonase 1 (PON1).
23305304 2013 Atherosclerosis and arteriosclerosis parameters in stroke patients associate with paraoxonase polymorphism and esterase activities.
23281178 2013 A genome-wide assessment of variability in human serum metabolism.
23278234 2013 PON1-108 TT and PON1-192 RR genotypes are more frequently encountered in Greek PCOS than non-PCOS women, and are associated with hyperandrogenaemia.
23207490 2013 LDL density and oxidation are modulated by PON1 promoter genotype in patients with Alzheimer's disease.
23204156 2012 The antioxidant status response to low-fat and walnut paste-enriched meat differs in volunteers at high cardiovascular Risk carrying different PON-1 polymorphisms.
23182497 2013 Positive correlation of paraoxonase 1 (PON1) activity with serum insulin level and HOMA-IR in dementia. A possible advantageous role of PON1 in dementia development.
23171143 2013 Association of paraoxonase1 gene Q192R polymorphism and apolipoprotein B in Asian Indian women with coronary artery disease risk.
23167629 2012 Common genetic variants in the myeloperoxidase and paraoxonase genes and the related cancer risk: a review.
23160181 2013 Novel common and rare genetic determinants of paraoxonase activity: FTO, SERPINA12, and ITGAL.
23159884 2013 Human paraoxonase double mutants hydrolyze V and G class organophosphorus nerve agents.
23137417 2013 Reduction of paraoxonase-1 activity may contribute the qualitative impairment of HDL particles in patients with type 2 diabetes.
23103709 2013 A study on serum advanced glycation end products and its association with oxidative stress and paraoxonase activity in type 2 diabetic patients with vascular complications.
23068968 2012 Reduced serum paraoxonase-1 levels in vitiligo: further evidence of oxidative stress.
23056015 2012 Association of paraoxonase activity and atherosclerosis in patients with chronic hepatitis B.
23054002 2012 R-carrying genotypes of serum paraoxonase (PON1) 192 polymorphism and higher activity ratio are related to susceptibility against ischemic stroke.
23053877 2013 Association of PON1 and PON2 polymorphisms with PON1 activity and significant coronary stenosis in a Tunisian population.
23007074 2012 Main determinants of PON1 activity in hemodialysis patients.
22982463 2012 Clinical and genetic association of serum paraoxonase and arylesterase activities with cardiovascular risk.
22976839 2012 NQO1 rs1800566 (C609T), PON1 rs662 (Q192R), and PON1 rs854560 (L55M) polymorphisms segregate the risk of childhood acute leukemias according to age range distribution.
22975224 2012 PON1 status does not influence cholinesterase activity in Egyptian agricultural workers exposed to chlorpyrifos.
22974728 2013 Besides CYP2C19, PON1 genetic variant influences post-clopidogrel platelet reactivity in Chinese patients.
22971504 2012 Paraoxonase-1 gene Q192R polymorphism and reactive oxygen metabolites.
22959975 2012 Human plasma paraoxonase 1 (PON1) arylesterase activity during aging: correlation with susceptibility of LDL oxidation.
22956172 2013 Regulatory regions of the paraoxonase 1 (PON1) gene are associated with neovascular age-related macular degeneration (AMD).
22952763 2012 Expression of human paraoxonase 1 decreases superoxide levels and alters bacterial colonization in the gut of Drosophila melanogaster.
22934769 2012 Oxidized-LDL and paraoxonase-1 as biomarkers of coronary artery disease in patients with sleep-disordered breathing.
22896672 2012 Dietary cholesterol increases paraoxonase 1 enzyme activity.
22890407 2013 High-density lipoprotein impedes glycation of low-density lipoprotein.
22884547 2012 Association analysis of PON polymorphisms in sporadic ALS in a Chinese population.
22868806 2012 Monocyte chemoattractant protein-1 and paraoxonase-1 and 3 levels in patients with sepsis treated in an intensive care unit: a preliminary report.
22854640 2012 Paraoxonase 1 (PON1) C/T-108 association with longitudinal mean arterial blood pressure.
22847926 2012 Application of the buccal micronucleus cytome assay and analysis of PON1Gln192Arg and CYP2A6*9(-48T>G) polymorphisms in tobacco farmers.
22846213 2012 Paraoxonase-1 is not associated with coronary artery calcification in type 2 diabetes: results from the PREDICT study.
22835076 2012 Paraoxonase 1 (PON1) 55 polymorphism, lipid profiles and psoriasis.
22822045 2012 Altered inflammation, paraoxonase-1 activity and HDL physicochemical properties in obese humans with and without Prader-Willi syndrome.
22813564 PONI and its association with oxidative stress in type I and type II diabetes mellitus.
22800774 2013 Relationship between the paraoxonase 1 (PON1) M55L and Q192R polymorphisms and lymphohaematopoietic cancers in a Greek agricultural population.
22796398 2012 Higher frequency of paraoxonase gene polymorphism and cardiovascular impairment among Brazilian Fabry Disease patients.
22776645 2012 Lack of an association between Paraoxonase 1 gene polymorphisms (Q192R, L55M) and Alzheimer's disease: a meta-analysis.
22751611 2012 Serum paraoxonase 1 heteroplasmon, a fucosylated, and sialylated glycoprotein in distinguishing early hepatocellular carcinoma from liver cirrhosis patients.
22750797 2012 Two- and three-locus haplotypes of the paraoxonase (PON1) gene are associated with coronary artery disease in Asian Indians.
22750393 2012 ?-carotene reverses the IL-1?-mediated reduction in paraoxonase-1 expression via induction of the CaMKKII pathway in human endothelial cells.
22723959 2012 Paraoxonase-1 is not a major determinant of stent thrombosis in a Taiwanese population.
22704918 2012 Association of a protective paraoxonase 1 (PON1) polymorphism in Parkinson's disease.
22703625 2012 Evaluation of endothelial dysfunction, lipid metabolism in women with polycystic ovary syndrome: relationship of paraoxonase 1 activity, malondialdehyde levels, low-density lipoprotein subfractions, and endothelial dysfunction.
22659076 2012 Paraoxonase 1 (PON1) as a marker of short term death in breast cancer recurrence.
22631428 2013 PON gene polymorphisms and ischaemic stroke: a systematic review and meta analysis.
22616668 2012 Paraoxonase-1 activity and oxidative status in patients with knee osteoarthritis and their relationship with radiological and clinical parameters.
22615820 2012 Paraoxonase 1 polymorphism and prenatal pesticide exposure associated with adverse cardiovascular risk profiles at school age.
22568797 2012 Paraoxonase and arylesterase activities in children with iron deficiency anemia and vitamin B12 deficiency anemia.
22555481 2012 Paraoxonase 1 polymorphisms in patients with primary glomerulonephritis: a single-center study in Turkey.
22521594 2012 Paraoxonase 1 polymorphisms L55M and Q192R were not risk factors for Parkinson's disease: a HuGE review and meta-analysis.
22520065 2012 Influence of the paraoxonase-1 Q192R genetic variant on clopidogrel responsiveness and recurrent cardiovascular events: a systematic review and meta-analysis.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22428615 2012 The paraoxonase-1 pathway is not a major bioactivation pathway of clopidogrel in vitro.
22401958 2012 Differences in amino acid residues in the binding pockets dictate substrate specificities of mouse senescence marker protein-30, human paraoxonase1, and squid diisopropylfluorophosphatase.
22378349 2012 Low high-density lipoprotein cholesterol is not responsible for decreased paraoxonase activity in chronic renal failure.
22367101 2012 Association of genetic polymorphisms in the paraoxonase 1 gene with the risk and prognosis of non-small cell lung cancer in Chinese Han population.
22333293 2012 Low serum PON1 activity: an independent risk factor for coronary artery disease in North-West Indian type 2 diabetics.
22322559 2012 Differential effects of paraoxonase 1 (PON1) polymorphisms on cancer risk: evidence from 25 published studies.
22320866 2012 Quantitative assessment of the influence of paraoxonase 1 activity and coronary heart disease risk.
22301914 2012 Evidence for association between paraoxonase 1 gene polymorphisms and polycystic ovarian syndrome in southwest Chinese women.
22285382 2012 Paraoxonase activity in healthy, diabetic, and hemodialysis patients.
22247228 2012 Decreased paraoxonase 1 (PON1) lactonase activity in hemodialyzed and renal transplanted patients. A novel cardiovascular biomarker in end-stage renal disease.
22222492 2012 Lower serum paraoxonase-1 activity is related to linoleic and docosahexanoic fatty acids in type 2 diabetic patients.
22206979 2012 Genetic variants in antioxidant genes are associated with sperm DNA damage and risk of male infertility in a Chinese population.
22193970 2012 Docking and molecular dynamics simulation studies on glycation-induced conformational changes of human paraoxonase 1.
22188760 2012 Serum PON-1 activity but not Q192R polymorphism is related to the extent of atherosclerosis.
22168506 2012 Assessment of paraoxonase 1, xanthine oxidase and glutathione peroxidase activities, nitric oxide and thiol levels in women with polycystic ovary syndrome.
22133529 2012 Paraoxonase 1 genetic polymorphisms and susceptibility to breast cancer: a meta-analysis.
22123566 [Paraoxonase-1 (PON1) activity in patients with coronary artery diseases and in diabetic patients].
22115701 2012 Lack of association between serum paraoxonase-1 activity and residual platelet aggregation during dual anti-platelet therapy.
22098435 2011 Urinary 8-hydroxy-2'-deoxyguanosine level and plasma paraoxonase 1 activity with Alzheimer's disease.
22086979 2012 Paraoxonase 1 as a major bioactivating hydrolase for olmesartan medoxomil in human blood circulation: molecular identification and contribution to plasma metabolism.
22074696 2012 Longitudinal changes in PON1 activities, PON1 phenotype distribution and oxidative status throughout normal pregnancy.
22067439 2012 The anti-inflammatory effect of paraoxonase 1 against oxidized lipids depends on its association with high density lipoproteins.
22030099 2012 Association between PON1 activity and coronary heart disease risk: a meta-analysis based on 43 studies.
22029190 2011 Determination of oxygen derived free radicals producer (xanthine oxidase) and scavenger (paraoxonase1) enzymes and lipid parameters in different cancer patients.
21997314 2012 Evaluation of oxidative stress, the activities of paraoxonase and arylesterase in patients with subclinical hypothyroidism.
21986144 2011 Serum levels of lipids, lipoproteins and paraoxonase activity in pre-eclampsia.
21982484 2011 Interaction of folate intake and the paraoxonase Q192R polymorphism with risk of incident coronary heart disease and ischemic stroke: the atherosclerosis risk in communities study.
21960992 2012 Low levels of serum paraoxonase activities are characteristic of metabolic syndrome and may influence the metabolic-syndrome-related risk of coronary artery disease.
21960140 2011 Relationship of human paraoxonase-1 serum activity and genotype with atherosclerosis in individuals from the Deep South.
21918510 2011 Effect of paraoxonase-1 polymorphism on clinical outcomes in patients treated with clopidogrel after an acute myocardial infarction.
21911985 Assessment of the role of paraoxonase gene polymorphism (Q192R) and paraoxonase activity in the susceptibility to atherosclerosis among lead-exposed workers.
21907728 2011 Role of genetic polymorphisms of CYP1A1, CYP3A5, CYP2C9, CYP2D6, and PON1 in the modulation of DNA damage in workers occupationally exposed to organophosphate pesticides.
21904599 2011 Association of organophosphate pesticide exposure and paraoxonase with birth outcome in Mexican-American women.
21887553 2011 Polymorphisms in three obesity-related genes (LEP, LEPR, and PON1) and breast cancer risk: a meta-analysis.
21873946 2011 The concentration of thiobarbituric acid reactive substances (TBARS) and paraoxonase activity in blood of patients with osteoarthrosis after endoprosthesis implantation.
21864557 2011 Role of paraoxonase 1 (PON1) in organophosphate metabolism: implications in neurodegenerative diseases.
21829028 2011 Paraoxonase 1 gene polymorphisms do not influence the response to treatment in Alzheimer's disease.
21820612 2011 Association of L55M and Q192R polymorphisms of paraoxonase-1 gene with preeclampsia.
21806387 2011 Impact of genetic variants on post-clopidogrel platelet reactivity in patients after elective percutaneous coronary intervention.
21803130 2011 Serum paraoxonase-1 (PON1) activities (PONase/AREase) and polymorphisms in patients with type 2 diabetes mellitus in a North-West Indian population.
21783258 2012 Association between bipolar I disorder and the L55M and Q192R polymorphisms of the paraoxonase 1 (PON1) gene.
21765051 2012 Predictive role of multilocus genetic polymorphisms in cardiovascular disease and inflammation-related genes on chronic kidney disease in Type 2 diabetes--an 8-year prospective cohort analysis of 1163 patients.
21757906 2011 Paraoxonase gene polymorphism and the risk for Alzheimer's disease in the polish population.
21755523 2011 Paraoxonase 1 gene polymorphisms, paraoxonase/arylesterase activities and oxidized low-density lipoprotein levels in patients with migraine.
21748243 2011 Plasma paraoxonase-1, oxidized low-density lipoprotein and lipid peroxidation levels in gout patients.
21737961 2011 Serum paraoxonase 1 activity predicts arterial stiffness in renal transplant recipients.
21737645 2011 Paraoxonase-1 192/55 polymorphisms and the risk of lung cancer in a Turkish population.
21723555 2011 Serum paraoxonase activity and oxidative stress in patients with adult nephrotic syndrome.
21722818 2011 Lower serum paraoxonase-1 activity is related to higher serum amyloid a levels in metabolic syndrome.
21718208 2011 Associations of xenobiotic-metabolizing enzyme genotypes PON1Q192R, PON1L55M and CYP1A1*2A MspI with pathological symptoms of a rural population in south Greece.
21692977 2011 Relationship between paraoxonase-1 activity, its Q192R genetic variant and clopidogrel responsiveness in the ADRIE study.
21681430 2012 Synergism between paraoxonase Arg 192 and the angiotensin converting enzyme D allele is associated with severity of coronary artery disease.
21672555 2011 Normalization of gene expression using SYBR green qPCR: a case for paraoxonase 1 and 2 in Alzheimer's disease brains.
21655055 2011 Effects of intronic and exonic polymorphisms of paraoxonase 1 (PON1) gene on serum PON1 activity in a Korean population.
21629682 2011 Paraoxonase 1 (PON1) polymorphisms, haplotypes and activity in predicting cad risk in North-West Indian Punjabis.
21620813 2011 Polymorphisms of pon1 and pon2 genes in hemodialyzed patients.
21573798 2012 Association between paraoxonase-1 gene polymorphisms and risk of metabolic syndrome.
21561808 2011 Association between male infertility and genetic variability at the PON1/2 and GSTM1/T1 gene loci.
21557696 2011 Paraoxonase-1 is not affected in polycystic ovary syndrome without metabolic syndrome and insulin resistance, but oxidative stress is altered.
21545792 2011 Lack of association between paraoxonase 1 Q192R polymorphism and multiple sclerosis in relapse phase: A case-control study.
21539819 2011 Increased levels of total oxidant status and decreased activity of arylesterase in migraineurs.
21530644 2011 Paraoxonase 1 protects macrophages from atherogenicity of a specific triglyceride isolated from human carotid lesion.
21527445 2011 No association of paraoxonase-1 Q192R genotypes with platelet response to clopidogrel and risk of stent thrombosis after coronary stenting.
21521796 2011 Human paraoxonase 1 is the enzyme responsible for pilocarpine hydrolysis.
21505009 2011 The relationship of PON1 QR 192 and LM 55 polymorphisms with serum paraoxonase activities of Turkish diabetic patients.
21465165 2011 Paraoxonase Arg 192 allele is an independent risk factor for three-vessel stenosis of coronary artery disease.
21450592 2011 Multifactor dimensionality reduction analysis of MTHFR, PAI-1, ACE, PON1, and eNOS gene polymorphisms in patients with early onset coronary artery disease.
21446159 [Q192R polymorphism of PON-1 gene in type 2 diabetic patients].
21438666 Association of PON1 and APOA5 gene polymorphisms in a cohort of Indian patients having coronary artery disease with and without type 2 diabetes.
21427447 2011 Paraoxonase-1 and oxidative status in common Mediterranean ?-thalassaemia mutations trait, and their relations to atherosclerosis.
21407247 2011 Effect of walnut-enriched meat on the relationship between VCAM, ICAM, and LTB4 levels and PON-1 activity in ApoA4 360 and PON-1 allele carriers at increased cardiovascular risk.
21360915 2010 [Smoking enhances the decrease of adiponectin level in patients with coronary artery disease, carriers of MTHFR 677T and PON1 55M alleles].
21355294 2011 [The -108 C/T polymorphism in paraoxonase 1 gene in Chinese patients with polycystic ovary syndrome].
21308654 2011 Investigating paraoxonase-1 gene Q192R and L55M polymorphism in patients with renal cell cancer.
21302675 2010 Paraoxonase 1 polymorphisms as the risk factor of coronary heart disease in a Thai population.
21291901 2011 Paraoxonase-1 genetic polymorphisms and susceptibility to DNA damage in workers occupationally exposed to organophosphate pesticides.
21287574 2011 First survey of the three gene polymorphisms (PON1 Q192R, eNOS E298D and eNOS C-786T) potentially associated with coronary artery spasm in African populations and comparison with worldwide data.
21268919 2010 [Paraoxonase--important enzyme of the lipid metabolism and potential ally in the antiatherosclerotic treatment].
21258965 2011 Biochemical, environmental, and genetic factors associated with paraoxonase (PON1) activity.
21231776 2011 C-reactive protein levels are associated with paraoxonase polymorphism L55M in patients undergoing cardiac SPECT imaging.
21229382 2011 Association of L55M and Q192R polymorphisms in paraoxonase 1 (PON1) gene with breast cancer risk and their clinical significance.
21223956 2011 Are PON1 Q/R 192 and M/L 55 polymorphisms risk factors for diabetes complications in Turkish population?
21187701 2011 Association of Paraoxonase 1 (PON1) polymorphisms with osteoporotic fracture risk in postmenopausal Korean women.
21170047 2011 Paraoxonase-1 is a major determinant of clopidogrel efficacy.
21167145 2011 Serum paraoxonase and arylesterase activities in patients with lacunar infarction: a case control study.
21162838 2010 [Relationship between paraoxonase/glutathione S-transferase gene polymorphism and health conditions of floriculture farmers].
21146823 2011 Four genetic polymorphisms of paraoxonase gene and risk of coronary heart disease: a meta-analysis based on 88 case-control studies.
21127310 Association of paraoxonase gene polymorphisms with sperm parameters.
21123122 2011 Differential hydrolysis of homocysteine thiolactone by purified human serum (192)Q and (192)R PON1 isoenzymes.
21118365 2010 Continuous reduction of plasma paraoxonase activity with increasing dialysis vintage in hemodialysis patients.
21111108 2010 Paraoxonase 1 gene and glutathione S-transferase ? 1 gene interaction with preterm delivery in Korean women.
21108196 2010 Serum paraoxonase 1 activity in women with metabolic syndrome.
21104436 2011 Paraoxonase 1 192 and 55 polymorphisms in osteosarcoma.
21078685 2011 Q192R polymorphism of the paraoxonase-1 gene as a risk factor for obesity in Portuguese women.
21059866 2011 Serum paraoxonase and arylesterase activities in metabolic syndrome in Zahedan, southeast Iran.
21044882 2011 Human carotid lesion linoleic acid hydroperoxide inhibits paraoxonase 1 (PON1) activity via reaction with PON1 free sulfhydryl cysteine 284.
21044781 2011 Genetic variants of connexin37 are associated with carotid intima-medial thickness and future onset of ischemic stroke.
21039385 2010 The frequency of early, spontaneous miscarriage associated with the leu33pro polymorphism of Glycoprotein IIIa: a pilot study.
21031563 2010 Paraoxonase 1 polymorphisms and haplotypes and the risk for having offspring affected with spina bifida in Southeast Mexico.
20981111 2011 Adenovirus-mediated human paraoxonase1 gene transfer to provide protection against the toxicity of the organophosphorus pesticide toxicant diazoxon.
20980077 2012 Serum paraoxonase activity is associated with variants in the PON gene cluster and risk of Alzheimer disease.
20961187 2011 Serum paraoxonase 1 (PON1) lactonase activity is lower in end-stage renal disease patients than in healthy control subjects and increases after hemodialysis.
20947215 2012 Paraoxonase-1 polymorphisms in Alzheimer's disease, Parkinson's disease, and AD-PD spectrum diseases.
20934178 2011 The three-gene paraoxonase family: physiologic roles, actions and regulation.
20921272 2011 'Dippers' flu' and its relationship to PON1 polymorphisms.
20883119 2011 Common polymorphisms in six genes of the methyl group metabolism pathway and obesity in European adolescents.
20872564 2010 Matrix metalloproteinase-9 and paraoxonase 1 Q/R192 gene polymorphisms and the risk of coronary artery stenosis in Iranian subjects.
20856122 2010 Paraoxonase 1 polymorphisms and ischemic stroke risk: A systematic review and meta-analysis.
20855565 2010 Common genetic variation in multiple metabolic pathways influences susceptibility to low HDL-cholesterol and coronary heart disease.
20850524 2011 HDL-associated paraoxonase-1 can redistribute to cell membranes and influence sensitivity to oxidative stress.
20845892 2010 Paraoxonase activity might be predictive of the severity of aortic valve stenosis.
20839225 2011 Effects of PON polymorphisms and haplotypes on molecular phenotype in Mexican-American mothers and children.
20833162 2010 The paraoxonase L55M and Q192R gene polymorphisms and myocardial infarction in a Tunisian population.
20820904 2011 PON1 55 and 192 gene polymorphisms in type 2 diabetes mellitus patients in a Turkish population.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20812194 2010 The L55M polymorphism of paraoxonase-1 is a risk factor for rheumatoid arthritis.
20807524 2010 Effect of non-genetic factors on paraoxonase 1 activity in patients undergoing hemodialysis.
20802378 2010 A multiplex MALDI-TOF MS approach facilitates genotyping of DNA from formalin-fixed paraffin-embedded tumour specimens.
20734577 2010 Interaction of paraoxonase-192 polymorphism with low HDL-cholesterol in coronary artery disease risk.
20723250 2010 Two common nonsynonymous paraoxonase 1 (PON1) gene polymorphisms and brain astrocytoma and meningioma.
20709049 2010 HDL 2 particles are associated with hyperglycaemia, lower PON1 activity and oxidative stress in type 2 diabetes mellitus patients.
20692246 2010 Paraoxonase activity in athletes with depleted iron stores and iron-deficient erythropoiesis.
20691716 2010 Interaction between organophosphate pesticide exposure and PON1 activity on thyroid function.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20664283 2010 Paraoxonase 1 polymorphisms 172T?A and 584A?G modify the association between serum concentrations of the antioxidant lycopene and bone turnover markers and oxidative stress parameters in women 25-70 years of age.
20658496 2010 Determinants of paraoxonase activity in healthy adults.
20646512 2010 [Relationship between Q192R polymorphisms in paraoxonase 1 gene and young ischemic stroke].
20639675 2010 Paraoxonase (PON1) gene polymorphisms in Fabry disease: correlation with renal disease.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20625960 The -A162G polymorphism of the PON1 gene and the risk of sporadic amyotrophic lateral sclerosis.
20615707 2010 Genetic polymorphisms of Chinese patients with ischemic stroke and concurrent stenoses of extracranial and intracranial vessels.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20582942 2010 Paraoxonase gene mutations in amyotrophic lateral sclerosis.
20577119 2010 Pharmacogenetic association of hypertension candidate genes with fasting glucose in the GenHAT Study.
20551012 2010 Homocysteinethiolactone and paraoxonase: novel markers of diabetic retinopathy.
20538124 2010 Genetic polymorphisms and the cardiovascular risk of non-steroidal anti-inflammatory drugs.
20536507 2010 Independent predictive roles of eotaxin Ala23Thr, paraoxonase 2 Ser311Cys and beta-adrenergic receptor Trp64Arg polymorphisms on cardiac disease in Type 2 Diabetes--an 8-year prospective cohort analysis of 1297 patients.
20532959 2010 Relationship between Paraoxonase 1 (PON1) gene polymorphisms and susceptibility of stroke: a meta-analysis.
20529763 2010 Evaluation of candidate genes for cholinesterase activity in farmworkers exposed to organophosphorus pesticides: association of single nucleotide polymorphisms in BCHE.
20510879 2010 Estradiol enhances cell-associated paraoxonase 1 (PON1) activity in vitro without altering PON1 expression.
20503442 2010 Human tissue distribution of paraoxonases 1 and 2 mRNA.
20497955 2010 Decreased human paraoxonase-1 activity in patients with Sjögren's syndrome.
20488557 2010 Decreased serum arylesterase activity in autism spectrum disorders.
20486838 2010 Serum paraoxonase activity in patients with low glomerular filtration rates.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20470383 2010 Decreased paraoxonase-1 activity is associated with alterations of high-density lipoprotein particles in chronic liver impairment.
20458968 [Polymorphism of paraoxonase (PON-1) gene in Slavonic part of Kharkiv population].
20458436 2010 Early-onset ischaemic stroke: analysis of 58 polymorphisms in 17 genes involved in methionine metabolism.
20453498 2010 Diet and paraoxonase 1 enzymatic activity in diabetic foot patients from Romania and Belgium: favorable association of high flavonoid dietary intake with arylesterase activity.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20430392 2010 No interaction between alcohol consumption and HDL-related genes on HDL cholesterol levels.
20424303 2010 Paraoxonase gene Q192R & L55M polymorphisms in Indians with acute myocardial infarction & association with oxidized low density lipoprotein.
20423481 2010 Lack of replication of genetic predictors for the rheumatoid arthritis response to anti-TNF treatments: a prospective case-only study.
20407783 2010 Paraoxonase 1 (PON1) polymorphisms and risk for migraine.
20406466 2010 Genetic variants associated with fasting blood lipids in the U.S. population: Third National Health and Nutrition Examination Survey.
20403997 2010 Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer.
20381198 2011 Lack of association of PON polymorphisms with sporadic ALS in an Italian population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20375196 2010 Genetic association between single nucleotide polymorphisms in the paraoxonase 1 (PON1) gene and small-for-gestational-age birth in related and unrelated subjects.
20362697 2010 No or only population-specific effect of PON1 on human longevity: a comprehensive meta-analysis.
20348046 [Paraoxonase 1 (PON1) activity and lipid parameters in Tunisian smokers].
20338154 2010 Human PON1, a biomarker of risk of disease and exposure.
20334584 2010 The role of chronic inflammation and Leu55Met PON1 polymorphism in the pathogenesis of polycystic ovary syndrome.
20227490 Neuropsychological and psychiatric functioning in sheep farmers exposed to low levels of organophosphate pesticides.
20227257 2011 Polymorphisms in the platelet-specific collagen receptor GP6 are associated with risk of nonfatal myocardial infarction in Caucasians.
20221880 2010 The contribution of high density lipoprotein apolipoproteins and derivatives to serum paraoxonase-1 activity and function.
20221879 2010 The effect of HDL mimetic peptide 4F on PON1.
20221878 2010 Paraoxonase 1 interactions with HDL, antioxidants and macrophages regulate atherogenesis - a protective role for HDL phospholipids.
20221877 2010 Anti-inflammatory properties of paraoxonase-1 in atherosclerosis.
20221876 2010 Alteration of PON1 activity in adult and childhood obesity and its relation to adipokine levels.
20221875 2010 The role of paraoxonase 1 in the detoxification of homocysteine thiolactone.
20221874 2010 Paraoxonase 1 attenuates human plaque atherogenicity: relevance to the enzyme lactonase activity.
20221873 2010 PON1 and oxidative stress in human sepsis and an animal model of sepsis.
20221868 2010 Paraoxonase 1 status as a risk factor for disease or exposure.
20221866 2010 Interrelationships between paraoxonase-1 and monocyte chemoattractant protein-1 in the regulation of hepatic inflammation.
20221865 2010 ApoE mimetic peptide reduces plasma lipid hydroperoxide content with a concomitant increase in HDL paraoxonase activity.
20209647 2011 BER gene polymorphisms (OGG1 Ser326Cys and XRCC1 Arg194Trp) and modulation of DNA damage due to pesticides exposure.
20198589 2010 Lack of association between paraoxonase-1 Q192R polymorphism and rheumatoid arthritis in southeast Iran.
20185366 2010 Genetic susceptibility factors for multiple chemical sensitivity revisited.
20156521 2010 Gene-environmental interactions and organophosphate toxicity.
20142115 2010 Influence of polymorphisms in candidate genes on early vascular alterations in obese children.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20133274 2010 Paraoxonase 1 R/Q alleles are associated with differential accumulation of saturated versus 20:5n3 fatty acid in human adipose tissue.
20100610 2010 Paraoxonase-1 in female infertility: a possible role against oxidative stress-induced inflammation.
20099504 2009 Assessment of serum paraoxonase and arylesterase activity in patients with endometrial cancer.
20098041 2009 [The relationship between paraoxanase gene Leu-Met (55) and Gln-Arg (192) polymorphisms and coronary artery disease].
20097953 2009 The role of genetic (PON1 polymorphism) and environmental factors, especially physical activity, in antioxidant function of paraoxonase.
20078877 2010 Gene polymorphisms in association with emerging cardiovascular risk markers in adult women.
20078196 2010 Paraoxonase-1 gene haplotypes are associated with metabolic disturbances, atherosclerosis, and immunologic outcome in HIV-infected patients.
20056567 2010 Childhood brain tumors, residential insecticide exposure, and pesticide metabolism genes.
20050883 2010 Paraoxonase 1 (PON1) polymorphisms and risk for essential tremor.
20045427 2010 Longitudinal changes in PON1 enzymatic activities in Mexican-American mothers and children with different genotypes and haplotypes.
20042177 2010 Protective effect of paraoxonase 1 gene variant Gln192Arg in age-related macular degeneration.
20026099 2010 The relationship between paraoxonase1-192 polymorphism and activity with coronary artery disease.
20019917 2009 Developmental changes in PON1 enzyme activity in young children and effects of PON1 polymorphisms.
19967651 Effect of paraoxonase 1 gene polymorphisms on clinical course of Henoch-Schönlein purpura.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19945920 2010 Integrative analytical approach by capillary electrophoresis and kinetics under high pressure optimized for deciphering intrinsic and extrinsic cofactors that modulate activity and stability of human paraoxonase (PON1).
19939821 2010 The role of polymorphisms within paraoxonases (192 Gln/Arg in PON1 and 311Ser/Cys in PON2) in the modulation of cardiovascular risk: a pilot study.
19930448 2010 Paraoxonase gene polymorphisms and stroke severity.
19915520 2010 Human paraoxonase-1 activity in childhood obesity and its relation to leptin and adiponectin levels.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19907334 2010 Paraoxonase 1, agricultural organophosphate exposure, and Parkinson disease.
19904013 Effect of atorvastatin on paraoxonase1 (PON1) and oxidative status.
19902814 2009 Lack of association between the paraoxonase 1 Q/R192 single nucleotide polymorphism and stroke in a Chinese cohort.
19902425 2009 Analysis of paraoxonase 1 (PON1) genetic polymorphisms and activities as risk factors for ischemic stroke in Turkish population.
19891963 2010 Effects of acetylsalicylic acid on serum paraoxonase activity, Ox-LDL, coenzyme Q10 and other oxidative stress markers in healthy volunteers.
19880629 2010 Paraoxonase 1 protects against protein N-homocysteinylation in humans.
19878569 2009 Candidate genetic analysis of plasma high-density lipoprotein-cholesterol and severity of coronary atherosclerosis.
19863653 2009 Involvement of paraoxonase 1 genetic variants in Alzheimer's disease neuropathology.
19850020 2010 Proatherogenic disturbances in lipoprotein profile, associated enzymes and transfer proteins in women with iron deficiency anaemia.
19846948 2009 192R allele of paraoxanase 1 (PON1) gene as a new marker for susceptibility to bladder cancer.
19826962 2010 Paraoxonase 1 polymorphisms are not related with the risk for multiple sclerosis.
19818126 2009 Single nucleotide polymorphisms in obesity-related genes and all-cause and cause-specific mortality: a prospective cohort study.
19778663 2009 Paraoxonase variants relate to 10-year risk in coronary artery disease: impact of a high-density lipoprotein-bound antioxidant in secondary prevention.
19770524 2009 Paraoxonase 1 gene polymorphisms contribute to coronary artery disease risk among north Indians.
19750105 2009 Serum cholinesterase inhibition in relation to paraoxonase-1 (PON1) status among organophosphate-exposed agricultural pesticide handlers.
19736056 2009 Associations of common variants in genes involved in metabolism and response to exogenous chemicals with risk of multiple myeloma.
19729601 2009 Candidate gene polymorphisms for ischemic stroke.
19710913 2009 Both paraoxonase-1 genotype and activity do not predict the risk of future coronary artery disease; the EPIC-Norfolk Prospective Population Study.
19672401 2009 Racial differences in paraoxonase-1 (PON1): a factor in the health of southerners?
19654933 2009 Paraoxonase gene polymorphism in south-western Korean population.
19651761 2009 The paraoxonase (PON1) Q192R polymorphism is not associated with poor health status or depression in the ELSA or INCHIANTI studies.
19646734 2009 Maternal exposure to floricultural work during pregnancy, PON1 Q192R polymorphisms and the risk of low birth weight.
19634497 2009 Gene-gene interaction affects coronary artery disease risk.
19628957 2009 The activities of paraoxonase, xanthine oxidase, adenosine deaminase and the level of nitrite in pseudoexfoliation syndrome.
19615988 2009 Relationships between paraoxon and 2-coumaranone hydrolytic activities in sera genotyped for PON1 Q192R polymorphism.
19602899 2009 Discordance in human paraoxonase-1 gene between phenotypes and genotypes in chronic kidney disease.
19597297 2009 Serum cystatin C is a determinant of paraoxonase activity in hemodialyzed and renal transplanted patients.
19587357 2009 A systematic meta-analysis of genetic association studies for diabetic retinopathy.
19579917 2009 Role of angiotensin converting enzyme, paraoxonase 1 55, 192 gene polymorphisms in syndrome X and coronary heart disease.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19575027 2009 Genetic variation of genes for xenobiotic-metabolizing enzymes and risk of bronchial asthma: the importance of gene-gene and gene-environment interactions for disease susceptibility.
19556304 2009 Gene expression profiling of experimental asthma reveals a possible role of paraoxonase-1 in the disease.
19540141 2009 Paraoxonase2 C311S polymorphism and low levels of HDL contribute to a higher mortality risk after acute myocardial infarction in elderly patients.
19538950 2009 Oxidant and antioxidant of arylesterase and paraoxonase as biomarkers in patients with hepatitis C virus.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19479237 2009 Phenotype-genotype interactions on renal function in type 2 diabetes: an analysis using structural equation modelling.
19474728 2009 The roles of PON1 and PON2 in cardiovascular disease and innate immunity.
19454508 Investigation of PON1 192 and PON1 55 polymorphisms in ovarian cancer patients in Turkish population.
19454176 2009 Association of paraoxonase 55 and 192 gene polymorphisms on serum homocysteine concentrations in preeclampsia.
19443958 2009 Paraoxonase 1 polymorphisms and risk of myocardial infarction in women and men.
19439227 2009 Expression and activity of paraoxonase 1 in human cataractous lens tissue.
19434854 IgG-paraoxonase-1 fusion protein for targeted drug delivery across the human blood-brain barrier.
19421925 2009 [Combined analyses of paraoxonase-1 and IGF-2 polymorphism in polycystic ovary syndrome].
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19401157 2009 Comparative expression analysis reveals differences in the regulation of intestinal paraoxonase family members.
19379515 2009 CYP17, GSTP1, PON1 and GLO1 gene polymorphisms as risk factors for breast cancer: an Italian case-control study.
19376276 2009 PON1 is a longevity gene: results of a meta-analysis.
19371607 2009 Risk of carotid atherosclerosis is associated with low serum paraoxonase (PON1) activity among arsenic exposed residents in Southwestern Taiwan.
19371602 2009 Paraoxonase 1 (PON1) modulates the toxicity of mixed organophosphorus compounds.
19359600 2009 Human paraoxonase gene cluster transgenic overexpression represses atherogenesis and promotes atherosclerotic plaque stability in ApoE-null mice.
19357718 2009 Genetic polymorphisms of paraoxonase-1 are associated with chronic kidney disease in Japanese women.
19330810 2009 Serum lipid profile paraoxonase and arylesterase activities in psoriasis.
19321847 2009 A large-scale international meta-analysis of paraoxonase gene polymorphisms in sporadic ALS.
19301736 2009 Paraoxonasel phenotype distribution in Thais.
19292048 2009 [Relationships between PON1 L55M polymorphism and coronary heart diseases complicated with fasting hyperglycemia in Han populations in Guangdong].
19288455 2009 Serum lipid profile, oxidative status, and paraoxonase 1 activity in hyperemesis gravidarum.
19285487 2009 Genetic determinants of plasma HDL-cholesterol levels in prepubertal children.
19280995 2008 Human paraoxonase gene polymorphisms and coronary artery disease risk.
19269283 2009 Association of homocysteine thiolactonase activity and PON1 polymorphisms with the severity of acute coronary syndrome.
19263529 2009 Genetic risk factors in recurrent venous thromboembolism: A multilocus, population-based, prospective approach.
19261989 2009 Altered flow-mediated vasodilatation, low paraoxonase-1 activity, and abnormal high-density lipoprotein subclass distribution in Takayasu's arteritis.
19254215 2009 [Association of genetic factors with clinical peculiarities of hypertensive disease in patients with burdened familial anamnesis].
19233152 2009 Hyperhomocysteinemia, paraoxonase concentration and cardiovascular complications in Tunisian patients with nondiabetic renal disease.
19233151 2009 Association between PON1 5'-regulatory region polymorphisms, PON1 activity and ischemic stroke.
19226538 2009 A preliminary study of human paraoxonase and PON 1 L/M55-PON 1 Q/R 192 polymorphisms in Turkish patients with coronary artery disease.
19223938 2010 Paraoxonase status and plasma butyrylcholinesterase activity in chlorpyrifos manufacturing workers.
19219535 2009 Association of genetic variants in Methylenetetrahydrofolate Reductase and Paraoxonase-1 genes with homocysteine, folate and vitamin B12 in coronary artery disease.
19207863 2009 Protective effect of paraoxonase 1 of high-density lipoprotein in type 2 diabetic patients with nephropathy.
19205543 [Low paraoxonase and arylesterase plasma activities in Mexican patients with coronary artery disease].
19204840 2009 Assessment of serum paraoxonase and arylesterase activities in early pregnancy failure.
19201174 2009 Myeloperoxidase and paraoxonase-1 in type 2 diabetic patients.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19155603 2009 Decreased serum paraoxonase 1 activity and increased serum homocysteine and malondialdehyde levels in age-related macular degeneration.
19152805 2009 Synergistic effect of polymorphisms of paraoxonase gene cluster and arsenic exposure on electrocardiogram abnormality.
19151417 2009 Association of the novel cardiovascular risk factors paraoxonase 1 and cystatin C in type 2 diabetes.
19135476 2009 Distribution of PON1 polymorphisms PON1Q192R and PON1L55M among Chinese, Malay and Indian males in Singapore and possible susceptibility to organophosphate exposure.
19131662 2009 A meta-analysis of candidate gene polymorphisms and ischemic stroke in 6 study populations: association of lymphotoxin-alpha in nonhypertensive patients.
19126404 2009 Combined effect of oxidative stress-related gene polymorphisms on atherosclerosis.
19121386 2009 Identification of paraoxonase-1 in induced sputum from healthy volunteers.
19104460 2009 Interaction between PON1 and population density in amyotrophic lateral sclerosis.
19103284 2009 Human carotid atherosclerotic plaque increases oxidative state of macrophages and low-density lipoproteins, whereas paraoxonase 1 (PON1) decreases such atherogenic effects.
19090870 2008 Paraoxonase-1 (PON1) activity as a risk factor for atherosclerosis in chronic renal failure patients.
19082953 2008 Paraoxonases (PON1, PON2, PON3) analyses in vitro and in vivo in relation to cardiovascular diseases.
19071155 2009 Paraoxonase 1 (PON1) status and substrate hydrolysis.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
19048631 2009 Oral facial clefts and gene polymorphisms in metabolism of folate/one-carbon and vitamin A: a pathway-wide association study.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
19022366 2009 Relation of PON1 and CYP1A1 genetic polymorphisms to clinical findings in a cross-sectional study of a Greek rural population professionally exposed to pesticides.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
19018779 2009 Apolipoprotein E and paraoxonase 1 polymorphisms are associated with lower serum thyroid hormones in postmenopausal women.
19018234 2008 Paraoxonase-1 55/192 genotypes in schizophrenic patients and their relatives in Turkish population.
19015224 2009 Polymorphisms in C2, CFB and C3 are associated with progression to advanced age related macular degeneration associated with visual loss.
19013297 2008 High glucose induces transactivation of the human paraoxonase 1 gene in hepatocytes.
19005291 2008 The relationships between PON1 activity as well as oxLDL levels and coronary artery lesions in CHD patients with diabetes mellitus or impaired fasting glucose.
19003935 2008 The relationship of oral disturbances of diabetes mellitus patients with paraoxonase gene polymorphisms.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18987736 2008 DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome.
18977341 2009 The measurement of the lactonase activity of paraoxonase-1 in the clinical evaluation of patients with chronic liver impairment.
18976644 2009 Arylesterase and paraoxonase activity of paraoxonase (PON1) affected by ischemia in the plasma of patients with arterial occlusion of the lower limbs.
18971955 2009 Determinants of variation in human serum paraoxonase activity.
18952040 2009 Paraoxonase activity against nerve gases measured by capillary electrophoresis and characterization of human serum paraoxonase (PON1) polymorphism in the coding region (Q192R).
18951406 2009 In silico analyses of substrate interactions with human serum paraoxonase 1.
18936436 2009 Prevalence in the United States of selected candidate gene variants: Third National Health and Nutrition Examination Survey, 1991-1994.
18930907 Paraoxonase-1 activity in subfertile men and relationship to sperm parameters.
18927546 2008 Lp(a) and risk of recurrent cardiac events in obese postinfarction patients.
18923238 2008 Association of paraoxonase activity and coronary collateral flow.
18845659 2009 Paraoxonase 1 activity in different types of multiple sclerosis.
18830558 2009 Low human paraoxonase predicts cardiovascular events in Japanese patients with type 2 diabetes.
18830194 2008 Combined impact of matrix metalloproteinase-3 and paraoxonase 1 55/192 gene variants on coronary artery disease in Turkish patients.
18823627 2009 Association of lipoprotein lipase D9N polymorphism with myocardial infarction in type 2 diabetes: the genetics, outcomes, and lipids in type 2 diabetes (GOLD) study.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18796237 2008 Assessment of paraoxonase activities in patients with knee osteoarthritis.
18728123 2008 Methylenetetrahydrofolate reductase C677T polymorphism is associated with central adiposity and increased androgenicity in healthy postmenopausal women.
18720901 2008 Genetic profiling of genes from the oxidative stress pathway among North and South Indians.
18716378 2008 Interethnic variability of plasma paraoxonase (PON1) activity towards organophosphates and PON1 polymorphisms among Asian populations--a short review.
18708400 2008 Genetic polymorphisms in the Paraoxonase 1 gene and risk of ovarian epithelial carcinoma.
18695162 2008 Association of paraoxonase gene cluster polymorphisms with ALS in France, Quebec, and Sweden.
18678600 2008 Dynamic variation in allele-specific gene expression of Paraoxonase-1 in murine and human tissues.
18665040 CYP A-204C polymorphism is associated with subclinical atherosclerosis in postmenopausal women.
18652773 The importance of paraoxonase 1 activity, nitric oxide and lipid peroxidation in hepatosteatosis.
18635682 2008 Genetic analysis of 56 polymorphisms in 17 genes involved in methionine metabolism in patients with abdominal aortic aneurysm.
18634772 2008 PON1 status is influenced by oxidative stress and inflammation in coronary heart disease patients.
18626964 2009 Paraoxonase-1 status in Crohn's disease and ulcerative colitis.
18624774 2010 Paraoxonase 1 activities and polymorphisms in autism spectrum disorders.
18618303 2008 A common haplotype within the PON1 promoter region is associated with sporadic ALS.
18615156 Genome-wide association scan identifies candidate polymorphisms associated with differential response to anti-TNF treatment in rheumatoid arthritis.
18601602 2008 High-density lipoprotein cholesterol and paraoxonase 1 (PON1) genetics and serum PON1 activity in prepubertal children in Spain.
18582459 2008 PON1Q192R polymorphism is associated with lipid profile in Mexican men with Mayan ascendancy.
18569577 2008 Sequence variations in subjects with self-reported multiple chemical sensitivity (sMCS): a case-control study.
18550589 2008 Evaluation of genetic damage in a Brazilian population occupationally exposed to pesticides and its correlation with polymorphisms in metabolizing genes.
18544231 2008 Paraoxonase-1 activity in patients with hyperemesis gravidarum.
18513389 2008 New application of intelligent agents in sporadic amyotrophic lateral sclerosis identifies unexpected specific genetic background.
18505467 2009 High plasma C-reactive protein (CRP) is related to low paraoxonase-I (PON-I) activity independently of high leptin and low adiponectin in type 2 diabetes mellitus.
18500687 2008 Paraoxonase 1 (PON1) polymorphisms and prostate cancer in the CPS-II Nutrition Cohort.
18497471 2008 The influence of PON1 192 polymorphism on endothelial function in diabetic subjects with or without hypertension.
18474147 2008 Levels of paraoxonase, an index of antioxidant defense, in patients with active sarcoidosis.
18469206 2008 Association between p.Leu54Met polymorphism at the paraoxonase-1 gene and plantar fascia thickness in young subjects with type 1 diabetes.
18465683 2008 Relationship of serum resistin level to traits of metabolic syndrome and serum paraoxonase 1 activity in a population with a broad range of body mass index.
18443916 2008 Study on a possible effect of four longevity candidate genes (ACE, PON1, PPAR-gamma, and APOE) on human fertility.
18433845 2009 Paraoxonase 1 gene promoter polymorphisms are associated with the extent of stenosis in coronary arteries.
18430447 2008 PON1Q192R genetic polymorphism modifies organophosphorous pesticide effects on semen quality and DNA integrity in agricultural workers from southern Mexico.
18430057 2008 Effect of statin therapy on plasma high-density lipoprotein-cholesterol levels is modified by paraoxonase 1 in Chinese patients with coronary heart disease.
18427977 2008 High-throughput multiplex single-nucleotide polymorphism (SNP) analysis in genes involved in methionine metabolism.
18423402 2008 Paraoxonase 1 (PON1) status in gastroesophageal malignancies and associated paraneoplastic syndromes - connection with inflammation.
18413200 Oxidative stress pathway genes and chronic renal insufficiency in Asian Indians with Type 2 diabetes.
18385941 2008 Relation of plasma protein oxidation parameters and paraoxonase activity in the ageing population.
18361900 2008 [Association between paraoxonase-1 and paraoxonase-2 polymorphisms and the risk of acute myocardial infarction].
18355454 2008 Paraoxonase and arylesterase activities in untreated dipper and non-dipper hypertensive patients.
18349088 2008 Relationship of paraoxonase 1 (PON1) gene polymorphisms and functional activity with systemic oxidative stress and cardiovascular risk.
18347314 2008 Paraoxonase 1 (PON1) organophosphate hydrolysis is not reduced in ALS.
18347034 2008 Dominant role of paraoxonases in inactivation of the Pseudomonas aeruginosa quorum-sensing signal N-(3-oxododecanoyl)-L-homoserine lactone.
18322397 2008 Polymorphisms at the paraoxonase 1 L55M and Q192R loci affect the pathophysiology of Alzheimer's disease: emphasis on the cholinergic system and beta-amyloid levels.
18281420 2008 Factors associated with paraoxonase genotypes and activity in a diverse, young, healthy population: the Coronary Artery Risk Development in Young Adults (CARDIA) study.
18274205 2007 Common variants APOC3, APOA5, APOE and PON1 are associated with variation in plasma lipoprotein traits in Greenlanders.
18260892 2007 [Genetic risk factors for development of myocardial infarction in young men living in North-West region of Russia].
18241625 2008 Association between the paraoxonase-1 192Q>R allelic variant and coronary endothelial dysfunction in patients with early coronary artery disease.
18236737 2007 Hb Q(India) and its interaction with beta-thalassaemia: a study of 64 cases from India.
18219093 2008 Protective effect of R allele of PON1 gene on the coronary artery disease in the presence of specific genetic background.
18164014 2008 Paraoxonase (PON1) and the risk for coronary heart disease and myocardial infarction in a general population of Dutch women.
18154731 2008 PON1 activity and total oxidant status in patients with active pulmonary tuberculosis.
18096166 2008 Paraoxonase (PON1) is associated with familial combined hyperlipidemia.
18083534 2008 Interactive effect of paraoxonase-1 Q192R polymorphism and smoking history on the lung function decline in grain workers.
18034366 2008 Lack of replication of genetic associations with human longevity.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18000171 2008 Serum paraoxonase-1 activity in women with endometriosis and its relationship with the stage of the disease.
17977159 2007 Paraoxonase levels in women with polycystic ovary syndrome.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17949258 2008 Paraoxonase 1 gene polymorphisms and enzyme activities in diabetes mellitus.
17936978 [Paraoxonase 1 gene polymorphism 192Q/R in old men and long-livers from Tatars ethnic group].
17936934 2007 Genetic variability in the cytochrome P450-paraoxonase 1 (PON1) pathway for detoxication of organophosphorus compounds.
17936248 2007 Decreased paraoxonase-1 activity is a risk factor for ischemic stroke in Koreans.
17920578 2008 Paraoxonase/arylesterase ratio, PON1 192Q/R polymorphism and PON1 status are associated with increased risk of ischemic stroke.
17900266 2008 Genetic variation in the paraoxonase-3 (PON3) gene is associated with serum PON1 activity.
17854416 2008 The paraoxonase gene polymorphism in stroke patients and lipid profile.
17716225 2007 Association between paraoxonase-1 Q192R polymorphism and lung function among Saskatchewan grain handlers.
17702780 2007 Paraoxonase promoter and intronic variants modify risk of sporadic amyotrophic lateral sclerosis.
17664137 2007 Paraoxonases are associated with intestinal inflammatory diseases and intracellularly localized to the endoplasmic reticulum.
17662690 2007 Oxidation-reduction potential and paraoxonase-arylesterase activity in trauma patients.
17651311 2007 Paraoxonase phenotype distribution in a healthy Iranian pop