Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.40
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 2.2e-03
Disease Target Count Z-score Confidence
Schizophrenia 503 0.0 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.600 2.2e-03

Synonym

Accession Q96KW2 C9J1I7
Symbols POM121L
POM121-L

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
19571809 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MGSFLSKLELSPSSPAQVRTDLPERPTKRRPPQPLHQVHRVQFVHRAHPAPRYRPVRRRPNLDPANPTTW      1 - 70
LANEAWRRFPMKKSQNSPLGPLPSDWWESYLKRTIWSLRHPRPIWSPVTIRITPPDQRVPPSTSPEDVIA     71 - 140
LAGLPPSEELADPCSKETVLRALRECRKGKGRLEEPLFPESLDSKRRSPETRPSAFKPLMKNGTLTSFVP    141 - 210
RPGPLKRSLHSWGSDHSLTKRPNCSSMSSLASIYRGGTLSSKRNAIGSSYSSCRNFSDPWKRSVPSVSFE    211 - 280
TPEWPIKKEKSCHRPSSPVPLVSDFESLGGSESSGQQNQKIPQLPSSPENLVSEIPPPQLGYAVSDENLT    281 - 350
LGKKAELQVSNNAGEDTTEVNTDPFPETWLAIQPSLSLALPSSETDLTQGANPQLENLRKMQKSLGPLAS    351 - 420
PQSTGEATSVAHSPLKTPSLPTPPGCSQSELLPGTSPDSKPTATFILLTPTSPTLPVTDTTWPPSTSQAD    421 - 490
RSPMPPDPPAPPTIQSTLLGMVSSPTSHLSASAPPDATSAHLMLKPILGPLHNSEIGSSSYSRISVTAAA    491 - 560
SSISSLSTIQGTLTPTFKPIFGSIDPLKTTPMIAPFSSKQTPPPFTHASTHHFHGLVKATSVVMSTTLAS    561 - 630
TSKDSVFKPPLDFGVVNVTSAVGNTYSVPSTCDTFLLGTAQAFRADFTPATGFIFPPHHHPTIPTVHTVT    631 - 700
MFTQVLSSVVQISPRSSTANFRGMGSPLPASALVSTNWLASTPSISNLTPAITSPLGSSSRPPFPLSQGA    701 - 770
NPQPAFGATNGQKQGPSQPALMPSVSSSFLFGSSAVALPTPMPTPAQPAFISTTQSALGCLTPSASTSQT    771 - 840
PASTWSGIGGIPAGFPISQASTTGFRIVIQTHQSGAFGSVFGSRAPQPFTFGGFVTPMDCDESGIIMTGP    841 - 910
DMSPTSGAFSIGALPSGTTNTMIPFGKGWSQNTEGLPSHRTAFSLGRGSISARKTMAPIAQNTPVPGQAK    911 - 980
AGSSVGFGMPFPPAQGSVGRGPFRSSASSFSIGAKSKTPKNREKGHSRRHHAYKK                   981 - 1035
//

Text Mined References (3)

PMID Year Title
23894747 2013 A comprehensive family-based replication study of schizophrenia genes.
19571809 2009 Common variants on chromosome 6p22.1 are associated with schizophrenia.
14574404 2003 The DNA sequence and analysis of human chromosome 6.