Property Summary

NCBI Gene PubMed Count 31
PubMed Score 37.76
PubTator Score 51.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Breast cancer 3098 4.8e-06
Disease Target Count Z-score Confidence
Rheumatic heart disease 8 3.274 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer -1.100 4.8e-06

Protein-protein Interaction (7)

Gene RIF (5)

PMID Text
26179916 The conserved features of the NLSs of ScHeh1, ScHeh2, and RnPom121 and the effective sorting of Heh2-derived reporters in human cells suggest that active import is conserved but confined to a small subset of INM proteins.
21289085 Data suggest that the nuclear migration of Pom121 and its subsequent interaction with inner nuclear membrane proteins are required to initiate interphase nuclear pore complex assembly.
20974814 The the N terminus of Pom121 directly binds the beta-propeller regions of Nup155 and Nup160.
20624389 The nuclear localization signal sites of Pom121 affect its function in nuclear pore complex assembly both by influencing nucleoporin interactions and pore membrane structure.
17900573 RNAi experiments showed that efficient depletion of both Pom121 proteins significantly reduces assembled nuclear pore complexes on nuclear envelope.

AA Sequence

MSPAAAAAGAGERRRPIASVRDGRGRGCGGPARAVLLGLSLVGLLLYLVPAAAALAWLTVGATAAWWGLS      1 - 70
REPRGSRPLSSFVRKARHRRPLSSFVRKARHRRTLFASPLAKSTANGNLLEPRTLLEGPDPAELLLMGSY     71 - 140
LGKPGPPQPAAAPEGQDLRDRPGRRPPARPAPRSPPPRSPPPRSPPPSPPTHRAHHVYPSLPTPLLRPSR    141 - 210
RPSPRDCGTLPNRFVITPRRRYPIHQAQYSCLGVLPTVCWNGYHKKAVLSPRNSRMVCSPVTVRIAPPDR    211 - 280
RFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSALKEKEKKRTVEEEDQIFLDGQENKRRRHDSSGSGH    281 - 350
SAFEPLVANGVPASFVPKPGSLKRGLNSQSSDDHLNKRSRSSSMSSLTGAYASGIPSSSRNAITSSYSST    351 - 420
RGISQLWKRNGPSSSPFSSPASSRSQTPERPAKKIREEELCHHSSSSTPLAADRESQGEKAADTTPRKKQ    421 - 490
NSNSQSTPGSSGQRKRKVQLLPSRRGEQLTLPPPPQLGYSITAEDLDLEKKASLQWFNQALEDKSDAASN    491 - 560
SVTETPPITQPSFTFTLPAAAPASPPTSLLAPSTNPLLESLKKMQTPPSLPPCPESAGAATTEALSPPKT    561 - 630
PSLLPPLGLSQSGPPGLLPSPSFDSKPPTTLLGLIPAPSMVPATDTKAPPTLQAETATKPQATSAPSPAP    631 - 700
KQSFLFGTQNTSPSSPAAPAASSAPPMFKPIFTAPPKSEKEGPTPPGPSVTATAPSSSSLPTTTSTTAPT    701 - 770
FQPVFSSMGPPASVPLPAPFFKQTTTPATAPTTTAPLFTGLASATSAVAPITSASPSTDSASKPAFGFGI    771 - 840
NSVSSSSVSTTTSTATAASQPFLFGAPQASAASFTPAMGSIFQFGKPPALPTTTTVTTFSQSLHTAVPTA    841 - 910
TSSSAADFSGFGSTLATSAPATSSQPTLTFSNTSTPTFNIPFGSSAKSPLPSYPGANPQPAFGAAEGQPP    911 - 980
GAAKPALAPSFGSSFTFGNSAAPAAAPTPAPPSMIKVVPAYVPTPIHPIFGGATHSAFGLKATASAFGAP    981 - 1050
ASSQPAFGGSTAVFFGAATSSGFGATTQTASSGSSSSVFGSTTPSPFTFGGSAAPAGSGSFGINVATPGS   1051 - 1120
STTTGAFSFGAGQSGSTATSTPFAGGLGQNALGTTGQSTPFAFNVSSTTESKPVFGGTATPTFGLNTPAP   1121 - 1190
GVGTSGSSLSFGASSAPAQGFVGVAPFGSAALSFSIGAGSKTPGARQRLQARRQHTRKK              1191 - 1249
//

Text Mined References (38)

PMID Year Title
26179916 2015 Conservation of inner nuclear membrane targeting sequences in mammalian Pom121 and yeast Heh2 membrane proteins.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21727197 2011 POM121 and Sun1 play a role in early steps of interphase NPC assembly.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21289085 2011 Localization of Pom121 to the inner nuclear membrane is required for an early step of interphase nuclear pore complex assembly.
20974814 2010 Pom121 links two essential subcomplexes of the nuclear pore complex core to the membrane.
20624389 2010 NLS-mediated NPC functions of the nucleoporin Pom121.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19782045 2009 The nuclear pore complex protein ALADIN is anchored via NDC1 but not via POM121 and GP210 in the nuclear envelope.
19620630 2009 Recruitment of functionally distinct membrane proteins to chromatin mediates nuclear envelope formation in vivo.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18824568 2008 Autonomy and robustness of translocation through the nuclear pore complex: a single-molecule study.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18596237 2008 Capture of AT-rich chromatin by ELYS recruits POM121 and NDC1 to initiate nuclear pore assembly.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17900573 2007 Two distinct human POM121 genes: requirement for the formation of nuclear pore complexes.
17577209 2007 The interactome of the histone gene regulatory factor HiNF-P suggests novel cell cycle related roles in transcriptional control and RNA processing.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16702234 2006 Nuclear pore complex assembly and maintenance in POM121- and gp210-deficient cells.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15657394 2005 Nuclear transport of single molecules: dwell times at the nuclear pore complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15304359 2004 Dynamic properties of nuclear pore complex proteins in gp210 deficient cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12228227 2002 Docking of HIV-1 Vpr to the nuclear envelope is mediated by the interaction with the nucleoporin hCG1.
11707516 2001 Sequential degradation of proteins from the nuclear envelope during apoptosis.
11448991 2001 Nuclear pore complexes form immobile networks and have a very low turnover in live mammalian cells.
10546895 1999 Function and assembly of nuclear pore complex proteins.
9847074 1998 Toward a complete human genome sequence.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
8335683 1993 An integral membrane protein of the pore membrane domain of the nuclear envelope contains a nucleoporin-like region.
7789967 1995 POM-ZP3, a bipartite transcript derived from human ZP3 and a POM121 homologue.