Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.07
PubTator Score 494.17

Knowledge Summary


No data available


  Disease (3)

Disease Target Count Z-score Confidence
Disease Progression 136 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Disease Target Count P-value
breast carcinoma 1638 3.3e-25
Breast cancer 3578 3.7e-09
malignant mesothelioma 3232 9.5e-06
osteosarcoma 7950 6.8e-05
invasive ductal carcinoma 2951 3.0e-03
lung cancer 4740 6.7e-03
astrocytic glioma 2597 8.0e-03
ependymoma 4679 2.5e-02
Disease Target Count Z-score Confidence
Hereditary spherocytosis type 5 12 3.685 1.8


  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.400 8.0e-03
Breast cancer 1.100 3.7e-09
breast carcinoma 1.100 3.3e-25
ependymoma -1.400 2.5e-02
invasive ductal carcinoma 1.600 3.0e-03
lung cancer 1.100 6.7e-03
malignant mesothelioma 1.100 9.5e-06
osteosarcoma -1.054 6.8e-05

Gene RIF (2)

AA Sequence

KCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD                                     71 - 108

Text Mined References (16)

PMID Year Title