Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.57
PubTator Score 494.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
breast carcinoma 1614 3.3e-25
Breast cancer 3098 3.7e-09
malignant mesothelioma 3163 9.5e-06
osteosarcoma 7933 6.8e-05
invasive ductal carcinoma 2950 3.0e-03
lung cancer 4473 6.7e-03
astrocytic glioma 2241 8.0e-03
ependymoma 2514 2.5e-02
Disease Target Count Z-score Confidence
Microphthalmia 79 3.493 1.7

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.100 9.5e-06
astrocytic glioma -1.400 8.0e-03
ependymoma -1.400 2.5e-02
osteosarcoma -1.054 6.8e-05
lung cancer 1.100 6.7e-03
breast carcinoma 1.100 3.3e-25
Breast cancer 1.100 3.7e-09
invasive ductal carcinoma 1.600 3.0e-03

Gene RIF (2)

PMID Text
17499043 Changes in Maf1 expression affect Pol III-dependent transcription in human glioblastoma lines.
1403646 HIV-1 Tat upregulates the transcription by RNA polymerase III of co-transfected or endogenous cellular Alu-repeated sequences by activating transcription factor TFIIIC

AA Sequence

MLLFCPGCGNGLIVEEGQRCHRFSCNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCP      1 - 70
KCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD                                     71 - 108
//

Text Mined References (16)

PMID Year Title
23446634 2013 Genome-wide association analysis of red blood cell traits in African Americans: the COGENT Network.
21269460 2011 Initial characterization of the human central proteome.
19631370 2009 RNA polymerase III detects cytosolic DNA and induces type I interferons through the RIG-I pathway.
19609254 2009 RIG-I-dependent sensing of poly(dA:dT) through the induction of an RNA polymerase III-transcribed RNA intermediate.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17499043 2007 Mammalian Maf1 is a negative regulator of transcription by all three nuclear RNA polymerases.
16728641 2006 A regulatory SNP causes a human genetic disease by creating a new transcriptional promoter.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12391170 2002 Characterization of human RNA polymerase III identifies orthologues for Saccharomyces cerevisiae RNA polymerase III subunits.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.
10079944 1998 [Molecular identification and characteristics of hRPC11, the smallest specific subunit of human RNA polymerase III].
9869639 1998 The RNA cleavage activity of RNA polymerase III is mediated by an essential TFIIS-like subunit and is important for transcription termination.
9054936 1997 The relationship between chromosome structure and function at a human telomeric region.
1403646 1992 The human immunodeficiency virus tat protein increases the transcription of human Alu repeated sequences by increasing the activity of the cellular transcription factor TFIIIC.