Property Summary

NCBI Gene PubMed Count 10
PubMed Score 13.10
PubTator Score 5.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 2.0e-137
lung carcinoma 2844 1.4e-21
lung cancer 4473 5.4e-04
group 4 medulloblastoma 1875 1.4e-03
osteosarcoma 7933 3.3e-03
Atopic dermatitis 944 5.0e-03
active Crohn's disease 918 1.8e-02
Disease Target Count Z-score Confidence
Capillary leak syndrome 2 3.241 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 2.400 2.0e-137
osteosarcoma -1.521 3.3e-03
Atopic dermatitis 1.100 5.0e-03
lung cancer 2.800 5.4e-04
active Crohn's disease 1.447 1.8e-02
group 4 medulloblastoma -1.200 1.4e-03
lung carcinoma 1.200 1.4e-21

 MGI Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (2)

PMID Text
21898682 Decreased levels of POLR3G result in loss of pluripotency and promote differentiation of human embryonic stem cells to all three germ layers but have no effect on cell apoptosis.
1403646 HIV-1 Tat upregulates the transcription by RNA polymerase III of co-transfected or endogenous cellular Alu-repeated sequences by activating transcription factor TFIIIC

AA Sequence

MAGNKGRGRAAYTFNIEAVGFSKGEKLPDVVLKPPPLFPDTDYKPVPLKTGEGEEYMLALKQELRETMKR      1 - 70
MPYFIETPEERQDIERYSKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAGPKPKKAKDAGKGTPLTNTED     71 - 140
VLKKMEELEKRGDGEKSDEENEEKEGSKEKSKEGDDDDDDDAAEQEEYDEEEQEEENDYINSYFEDGDDF    141 - 210
GADSDDNMDEATY                                                             211 - 223
//

Text Mined References (16)

PMID Year Title
24107381 2014 Gene duplication and neofunctionalization: POLR3G and POLR3GL.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21898682 2011 A novel role for an RNA polymerase III subunit POLR3G in regulating pluripotency in human embryonic stem cells.
21810746 2011 Genome-wide association study identifies variations in 6p21.3 associated with nevirapine-induced rash.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19631370 2009 RNA polymerase III detects cytosolic DNA and induces type I interferons through the RIG-I pathway.
19609254 2009 RIG-I-dependent sensing of poly(dA:dT) through the induction of an RNA polymerase III-transcribed RNA intermediate.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16341674 2005 Transcriptome analysis of human gastric cancer.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12391170 2002 Characterization of human RNA polymerase III identifies orthologues for Saccharomyces cerevisiae RNA polymerase III subunits.
9171375 1997 Three human RNA polymerase III-specific subunits form a subcomplex with a selective function in specific transcription initiation.
1403646 1992 The human immunodeficiency virus tat protein increases the transcription of human Alu repeated sequences by increasing the activity of the cellular transcription factor TFIIIC.