Property Summary

NCBI Gene PubMed Count 80
PubMed Score 29.29
PubTator Score 8.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Hereditary spherocytosis type 5 12 3.402 1.7

Expression

 GWAS Trait (1)

Gene RIF (82)

AA Sequence

MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHK      1 - 70
IIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE                            71 - 117
//

Text Mined References (82)

PMID Year Title