Property Summary

NCBI Gene PubMed Count 88
PubMed Score 13.50
PubTator Score 211.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia -1.700 4.4e-02
breast carcinoma 1.700 1.6e-03
lung adenocarcinoma 1.300 1.7e-13
lung cancer 2.200 2.3e-04
malignant mesothelioma 1.200 2.5e-06
Multiple myeloma 1.272 9.4e-04
non-small cell lung cancer 1.371 1.1e-23
ovarian cancer 2.800 1.4e-07

Gene RIF (82)

AA Sequence

MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTL      1 - 70
DDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSR     71 - 140
VYLLMKKLAF                                                                141 - 150
//

Text Mined References (94)

PMID Year Title