Property Summary

NCBI Gene PubMed Count 86
PubMed Score 13.93
PubTator Score 19.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.100 1.7e-03
atypical teratoid / rhabdoid tumor -1.600 2.8e-09
ependymoma -1.300 5.8e-03
glioblastoma -1.700 2.5e-05
group 4 medulloblastoma -1.100 1.9e-04
medulloblastoma, large-cell -1.400 4.2e-04
primitive neuroectodermal tumor -1.500 5.4e-05
psoriasis -1.500 1.1e-32
subependymal giant cell astrocytoma -1.108 1.2e-02

Gene RIF (82)

AA Sequence

MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRA      1 - 70
LQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD                  71 - 127
//

Text Mined References (87)

PMID Year Title