Property Summary

NCBI Gene PubMed Count 88
PubMed Score 25.99
PubTator Score 11.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 1.3e-04
Disease Target Count Z-score Confidence
Chikungunya 12 3.388 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 1.3e-04

Protein-protein Interaction (334)

POM121C   SUPT5H   TAF4   KMT2D   U2SURP   IPO8   NUPL2   POLR2D   KDM6A   DHX15   RNMT   PRPF4   SART1   HNRNPR   PRPF3   PPIH   PLRG1   NUDT21   DHX16   AQR   CDC40   CCNT1   PQBP1   RNGTT   PRPF40A   SF3B1   WBP4   SNRNP200   NUP155   CCNK   BCAS2   SMNDC1   SNAPC5   PRPF6   PCF11   CD2BP2   CPSF4   LSM8   SYF2   HNRNPC   SP1   SNRPB2   SNRNP70   SNRPA   SNRPC   HNRNPA1   SNRPA1   UBB   UBC   RARA   RARB   PCNA   TPR   RARG   GTF2F2   SNRPB   HNRNPL   RPA2   ERCC2   XRCC1   POLR2E   ERCC3   RXRA   TBP   TAF1   HNRNPA2B1   XPA   TCEA1   YY1   PAX6   U2AF2   PTBP1   RPA1   POLD1   ERCC5   GTF2E1   GTF2E2   TIA1   HNRNPH1   GTF2H1   CSTF2   RPA3   RFC4   RFC2   RFC1   GTF2F1   POLR2I   RBMX   RFC3   POLD2   TAF6   CDK7   CDK9   PAPOLA   CCNH   MNAT1   HNRNPA3   HNRNPM   POLR2H   POLR2J   HNRNPF   GTF2A1   GTF2A2   ZNF143   NUP98   POLR2K   SNU13   HNRNPH2   POLR2F   WDR5   HNRNPK   SNRPE   SNRPF   SNRPG   LSM3   LSM6   SNRPD1   SNRPD2   SNRPD3   POLR2G   HIST2H4A   RAN   POLR2L   RBX1   RPS27A   UBA52   TRA2B   SNURF   SUPT4H1   YBX1   HIST1H3F   LSM11   TXNL4A   SRSF3   H3F3B   GTF2B   HNRNPU   U2AF1   TIAL1   SRSF2   CSTF1   SRSF11   SRSF1   SRSF4   SSRP1   CPSF1   SF3A3   TAF10   CSTF3   GPS1   HNRNPA0   SRSF9   SRSF5   SRSF6   SF3B2   SNAPC2   SNW1   GTF2H2   GTF2H3   HNRNPD   ELOA   SLBP   NCOA6   WTAP   EFTUD2   POLD3   RNPS1   PCBP1   PCBP2   ELOC   ELOB   SF3B3   SF3B4   SF3A2   SF3A1   TAF5   TAF13   TAF11   TAF7   SF1   ZRSR2   TAF12   SNAPC1   SNRNP35   TAF9   SRSF7   UVSSA   USP39   NUP188   SNAPC4   CPSF3L   RPRD2   TAF3   ICE2   INTS3   SNRNP48   ESRP1   CDC73   TAF2   PRPF8   INTS5   CTR9   FIP1L1   CWC27   PAXIP1   GTF2H5   HIST2H3D   INTS8   SUPT6H   DDX46   COPS6   PHF5A   NUP54   TAF8   PABPN1   METTL3   ALYREF   DDX42   CHERP   SUGP1   CCAR1   NELFCD   RPAP2   SRRM1   ELOA2   TAF1L   NUP93   INTS1   ZC3H8   CPSF7   PAF1   PDCD7   PRPF38A   KMT2C   NUP35   ELOA3   ZCRB1   NUP210   ZNF473   U2AF1L4   NUP133   LEO1   SNRNP27   PRPF31   NELFB   RTF1   DHX38   NUP205   TAF4B   GTF2H4   SYMPK   ERCC4   COPS5   GPKOW   SNAPC3   CLP1   USP7   LSM10   MAGOHB   NABP1   PPWD1   INTS12   EAF2   SNRNP40   SEH1L   POM121   INTS4   RBM17   EAF1   RNPC3   ZNF830   RPRD1A   IWS1   VWA9   CDC5L   COPS8   NABP2   COPS4   PAGR1   NDC1   HNRNPUL1   DDX23   SNRNP25   NUP58   NUP85   SF3B5   UPF3B   CRNKL1   WDR33   WDR61   INTS2   CSTF2T   NELFA   ESRP2   PHAX   COPS7B   ELL3   TAF9B   METTL14   CWC22   XAB2   POLD4   INTS9   INTS7   ASUN   INTS10   RBM22   CWC25   CDK12   CWC15   CPSF2   ASH2L   POLK   COPS7A   ZMAT5   AFF4   PUF60   LSM7   CPSF3   AGO2   INTS6   ISY1   PRPF19   COPS3   SRRM2   ICE1   WBP11   LSM2   LSM5   LSM4   CTDP1   SUPT16H   RBM8A   NCOA3  

Gene RIF (86)

PMID Text
26455390 FUS low-complexicity phase separates to recruit RNA polymerase II C-terminal domain in vitro.
25211001 These findings suggest that N-terminus of Rpb3 selectively inhibits Rpb3-high-expression hepatocellular carcinoma cells proliferation. N-terminus of Rpb3 may be useful in treating patients diagnosed with Rpb3-high-expression hepatocellular carcinoma.
24359561 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
24330569 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
24217245 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
23827503 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
23274668 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
23087374 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
23028129 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
22567366 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
22422068 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
22421880 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
22229121 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
22211660 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
21972559 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
21360054 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
21217813 eEF1gamma, in addition to its role in translation elongation complex, is involved in regulating Vimentin gene by contacting both pol II and the Vimentin promoter region and shuttling/nursing the Vimentin mRNA
20471948 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
20227660 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
19526283 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18991615 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
18854154 Knockdown of polymerase (RNA) II (DNA directed) polypeptide C (POLR2C, 33kDa) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18218627 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
17661632 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
17168834 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
16838299 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
16455777 Rpb3 is a potential nuclear target of insulin-like growth factor binding protein-3
16289656 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
14569024 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
12887902 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
12860379 interaction between RPB3 and ATF4
12775419 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
12642036 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
12634356 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
12379213 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
12221105 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
12126615 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
12114499 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
12089333 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
12052871 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
12049628 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
11809800 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
11547919 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
11112772 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
11080476 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
10958691 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
10931842 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
10866664 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
10757782 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
10704353 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
10698937 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
10617616 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
10545121 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
10536359 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
10438593 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
10393184 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
10373521 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
10364292 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
10359081 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
10329125 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
10069959 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
10066804 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
9874563 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
9765201 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
9696809 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
9651670 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
9570510 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
9491887 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
9334327 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
9315662 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
9311822 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
9184228 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
9121429 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
9054383 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
8934526 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
8910388 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
8876177 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
8849451 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
8800208 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
8676484 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
8637904 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
7853496 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
7638159 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
2190099 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter
1559613 The interaction of Tip110 with HIV-1 Tat leads to a higher efficiency of elongation for RNAPII complexes formed on the LTR promoter

AA Sequence

MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGL      1 - 70
IPLISDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPN     71 - 140
DYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSE    141 - 210
LDEDESQAPYDPNGKPERFYYNVESCGSLRPETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN         211 - 275
//

Text Mined References (92)

PMID Year Title
26455390 2015 Residue-by-Residue View of In Vitro FUS Granules that Bind the C-Terminal Domain of RNA Polymerase II.
25211001 2014 Rpb3 promotes hepatocellular carcinoma through its N-terminus.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
21217813 2010 The eEF1? subunit contacts RNA polymerase II and binds vimentin promoter region.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16455777 2006 Ribonucleic acid polymerase II binding subunit 3 (Rpb3), a potential nuclear target of insulin-like growth factor binding protein-3.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15282305 2004 RPAP1, a novel human RNA polymerase II-associated protein affinity purified with recombinant wild-type and mutated polymerase subunits.
14569024 2003 The Tat/TAR-dependent phosphorylation of RNA polymerase II C-terminal domain stimulates cotranscriptional capping of HIV-1 mRNA.
12887902 2003 Acetylation of Tat defines a cyclinT1-independent step in HIV transactivation.
12860379 2003 Functional interaction of the subunit 3 of RNA polymerase II (RPB3) with transcription factor-4 (ATF4).
12676794 2003 The RNA polymerase II elongation complex.
12642036 2003 HIV-1 Vpr binding to HIV-1 LTR C/EBP cis-acting elements and adjacent regions is sequence-specific.
12634356 2003 Human immunodeficiency virus type 1 (HIV-1) Vpr enhances expression from unintegrated HIV-1 DNA.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12379213 2002 Transcription factor TFIIH components enhance the GR coactivator activity but not the cell cycle-arresting activity of the human immunodeficiency virus type-1 protein Vpr.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
12221105 2002 Transcriptional activators differ in their abilities to control alternative splicing.
12207009 2002 The alpha-like RNA polymerase II core subunit 3 (RPB3) is involved in tissue-specific transcription and muscle differentiation via interaction with the myogenic factor myogenin.
12126615 2002 A bimolecular mechanism of HIV-1 Tat protein interaction with RNA polymerase II transcription elongation complexes.
12114499 2002 HIV-1 Tat interaction with RNA polymerase II C-terminal domain (CTD) and a dynamic association with CDK2 induce CTD phosphorylation and transcription from HIV-1 promoter.
12052871 2002 Phosphorylation of the RNA polymerase II carboxyl-terminal domain by CDK9 is directly responsible for human immunodeficiency virus type 1 Tat-activated transcriptional elongation.
12049628 2002 HIV-1 Tat-associated RNA polymerase C-terminal domain kinase, CDK2, phosphorylates CDK7 and stimulates Tat-mediated transcription.
11809800 2002 Spt5 cooperates with human immunodeficiency virus type 1 Tat by preventing premature RNA release at terminator sequences.
11547919 2001 Multiple modes of transcriptional regulation by the HIV-1 Tat transactivator.
11112772 2001 DSIF and NELF interact with RNA polymerase II elongation complex and HIV-1 Tat stimulates P-TEFb-mediated phosphorylation of RNA polymerase II and DSIF during transcription elongation.
11080476 2000 Acetylation of HIV-1 Tat by CBP/P300 increases transcription of integrated HIV-1 genome and enhances binding to core histones.
10958691 2000 CDK9 autophosphorylation regulates high-affinity binding of the human immunodeficiency virus type 1 tat-P-TEFb complex to TAR RNA.
10931842 2000 Cooperative interaction between HIV-1 regulatory proteins Tat and Vpr modulates transcription of the viral genome.
10866664 2000 Tat modifies the activity of CDK9 to phosphorylate serine 5 of the RNA polymerase II carboxyl-terminal domain during human immunodeficiency virus type 1 transcription.
10784442 2000 Architecture of RNA polymerase II and implications for the transcription mechanism.
10777215 2000 A murine ATFa-associated factor with transcriptional repressing activity.
10757782 2000 Domains in the SPT5 protein that modulate its transcriptional regulatory properties.
10725406 2000 BRCA1 interaction with RNA polymerase II reveals a role for hRPB2 and hRPB10alpha in activated transcription.
10704353 2000 Phosphorylation of the RAP74 subunit of TFIIF correlates with Tat-activated transcription of the HIV-1 long terminal repeat.
10698937 2000 TIP30 has an intrinsic kinase activity required for up-regulation of a subset of apoptotic genes.
10617616 2000 Requirement for a kinase-specific chaperone pathway in the production of a Cdk9/cyclin T1 heterodimer responsible for P-TEFb-mediated tat stimulation of HIV-1 transcription.
10567706 1999 Interactions between the full complement of human RNA polymerase II subunits.
10545121 1999 HIV-1 tat transcriptional activity is regulated by acetylation.
10536359 1999 Regulatory functions of Cdk9 and of cyclin T1 in HIV tat transactivation pathway gene expression.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.
10438593 1999 Direct evidence that HIV-1 Tat stimulates RNA polymerase II carboxyl-terminal domain hyperphosphorylation during transcriptional elongation.
10393184 1999 A novel RNA polymerase II-containing complex potentiates Tat-enhanced HIV-1 transcription.
10373521 1999 Transcriptional cofactor CA150 regulates RNA polymerase II elongation in a TATA-box-dependent manner.
10364292 1999 Human and rodent transcription elongation factor P-TEFb: interactions with human immunodeficiency virus type 1 tat and carboxy-terminal domain substrate.
10359081 1999 The HIV-1 Vpr co-activator induces a conformational change in TFIIB.
10329125 1999 Cyclin T1 domains involved in complex formation with Tat and TAR RNA are critical for tat-activation.
10069959 1999 Human immunodeficiency virus type 1 Tat-dependent activation of an arrested RNA polymerase II elongation complex.
10066804 1999 Tat-associated kinase (P-TEFb): a component of transcription preinitiation and elongation complexes.
9874563 1999 The HIV-1 virion-associated protein vpr is a coactivator of the human glucocorticoid receptor.
9852112 1998 Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope-tagged subunits of the multiprotein complexes.
9790902 1998 Cloning and characterization of three human cDNAs encoding mRNA (guanine-7-)-methyltransferase, an mRNA cap methylase.
9765201 1998 The HIV-1 Tat cellular coactivator Tat-SF1 is a general transcription elongation factor.
9696809 1998 The ability of positive transcription elongation factor B to transactivate human immunodeficiency virus transcription depends on a functional kinase domain, cyclin T1, and Tat.
9651670 1998 Transcriptional control: Tat cofactors and transcriptional elongation.
9607318 1998 The interacting RNA polymerase II subunits, hRPB11 and hRPB3, are coordinately expressed in adult human tissues and down-regulated by doxorubicin.
9570510 1998 Tat, Tat-associated kinase, and transcription.
9540830 1998 Cloning and characterization of the human RNA polymerase I subunit hRPA40.
9512541 1998 Isolation and characterization of a human cDNA for mRNA 5'-capping enzyme.
9491887 1998 A novel CDK9-associated C-type cyclin interacts directly with HIV-1 Tat and mediates its high-affinity, loop-specific binding to TAR RNA.
9488465 1998 EWS, but not EWS-FLI-1, is associated with both TFIID and RNA polymerase II: interactions between two members of the TET family, EWS and hTAFII68, and subunits of TFIID and RNA polymerase II complexes.
9409616 1997 Purification and cDNA cloning of the AdoMet-binding subunit of the human mRNA (N6-adenosine)-methyltransferase.
9405375 1997 Three transitions in the RNA polymerase II transcription complex during initiation.
9334327 1997 The HIV transactivator TAT binds to the CDK-activating kinase and activates the phosphorylation of the carboxy-terminal domain of RNA polymerase II.
9315662 1997 CA150, a nuclear protein associated with the RNA polymerase II holoenzyme, is involved in Tat-activated human immunodeficiency virus type 1 transcription.
9311822 1997 A human primary T-lymphocyte-derived human immunodeficiency virus type 1 Tat-associated kinase phosphorylates the C-terminal domain of RNA polymerase II and induces CAK activity.
9201987 1997 Interactions between the human RNA polymerase II subunits.
9184228 1997 Purification of a Tat-associated kinase reveals a TFIIH complex that modulates HIV-1 transcription.
9121429 1997 The human immunodeficiency virus transactivator Tat interacts with the RNA polymerase II holoenzyme.
9054383 1997 Association of Tat with purified HIV-1 and HIV-2 transcription preinitiation complexes.
8946909 1996 The general transcription factors of RNA polymerase II.
8934526 1996 Enhanced processivity of RNA polymerase II triggered by Tat-induced phosphorylation of its carboxy-terminal domain.
8910388 1996 Requirements for RNA polymerase II carboxyl-terminal domain for activated transcription of human retroviruses human T-cell lymphotropic virus I and HIV-1.
8876177 1996 Trans-activation by human immunodeficiency virus Tat protein requires the C-terminal domain of RNA polymerase II.
8849451 1996 Tat-SF1: cofactor for stimulation of transcriptional elongation by HIV-1 Tat.
8800208 1996 The human immunodeficiency virus type 1 Vpr transactivator: cooperation with promoter-bound activator domains and binding to TFIIB.
8676484 1996 The human immunodeficiency virus Tat proteins specifically associate with TAK in vivo and require the carboxyl-terminal domain of RNA polymerase II for function.
8637904 1996 Human immunodeficiency virus type-1 Tat is an integral component of the activated transcription-elongation complex.
8034326 1994 Chromosomal localization of human RNA polymerase II subunit genes.
7853496 1995 Lentivirus Tat proteins specifically associate with a cellular protein kinase, TAK, that hyperphosphorylates the carboxyl-terminal domain of the large subunit of RNA polymerase II: candidate for a Tat cofactor.
7638159 1995 Specific binding of RNA polymerase II to the human immunodeficiency virus trans-activating region RNA is regulated by cellular cofactors and Tat.
2449431 1988 ATP activates transcription initiation from promoters by RNA polymerase II in a reversible step prior to RNA synthesis.
2190099 1990 Activation of transcription by HIV-1 Tat protein tethered to nascent RNA through another protein.
2187864 1990 The amino acid sequence of the human RNA polymerase II 33-kDa subunit hRPB 33 is highly conserved among eukaryotes.
1939271 1991 Abortive initiation is increased only for the weakest members of a set of down mutants of the adenovirus 2 major late promoter.
1559613 1992 HIV-1 Tat acts as a processivity factor in vitro in conjunction with cellular elongation factors.
12345 1976 A new granulation method for compressed tablets [proceedings].