Property Summary

NCBI Gene PubMed Count 32
PubMed Score 2.05
PubTator Score 32.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Breast cancer 1.700 1.7e-13
malignant mesothelioma 2.500 4.4e-08
osteosarcoma -1.485 1.2e-02
glioblastoma 1.300 2.3e-04
sonic hedgehog group medulloblastoma 1.600 1.5e-06
atypical teratoid / rhabdoid tumor 1.300 2.6e-07
medulloblastoma, large-cell 1.600 2.6e-05
primitive neuroectodermal tumor 1.500 1.4e-03
adrenocortical carcinoma 1.235 1.8e-04
non-small cell lung cancer 1.320 1.7e-15
intraductal papillary-mucinous neoplasm ... 1.900 1.3e-03
colon cancer 1.700 7.0e-03
lung cancer 1.900 3.2e-05
pediatric high grade glioma 1.200 3.2e-05
ovarian cancer 2.000 4.9e-15
psoriasis 1.500 5.5e-60

 GO Component (2)

Gene RIF (27)

PMID Text
25775267 Polymerase theta; uses a specialized thumb subdomain to establish unique upstream contacts to the primer DNA strand.
25643323 Microhomology-mediated end-joining is dependent on Poltheta; in human cells.
25642963 results reveal a synthetic lethal relationship between the homologous-recombination pathway and Poltheta;-mediated repair in epithelial ovarian cancers, and identify Poltheta; as a novel druggable target for cancer therapy
25642960 depletion of Poltheta; has a synergistic effect on cell survival in the absence of BRCA genes, suggesting that the inhibition of this mutagenic polymerase represents a valid therapeutic avenue for tumours carrying mutations in homology-directed repair genes
25417172 These results suggest that variants in the POLQ gene may be associated with the risk of Luminal breast cancer
25409685 A DNA repair variant in POLQ (c.-1060A > G) is associated to hereditary breast cancer patients.
24648516 A role for DNA polymerase theta; in promoting replication through oxidative DNA lesion, thymine glycol, in human cells.
23577232 Use fluorescence resonance energy transfer to monitor assembly of the human replicative polymerase holoenzyme.
22135286 POLQ possesses a DNA polymerase activity that appears to be template independent and allows efficient extension of single-stranded DNA as well as duplex DNA with either protruding or multiply mismatched 3'-OH termini.
20700469 overexpression in breast cancer confers an adverse prognosis and is associated with key cancer pathways
20624954 Data show that POLQ overexpression may be a promising genetic instability and prognostic marker for breast cancer.
19661089 Observational study of gene-disease association. (HuGE Navigator)
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19188258 Domain mapping of the 98-kDa enzyme by limited proteolysis and NaBH(4) cross-linking with a base excision repair intermediate revealed that the dRP lyase active site resides in a 24-kDa domain of Pol theta.
18503084 When copying undamaged DNA, DNA polymerase theta generates single base errors at rates 10- to more than 100-fold higher than for other family A members.
18366182 Evolutionary conservation of efficient T[CPD]T bypass by HsPoleta and AtPoleta may reflect a high degree of exposure of human skin and plants to solar UV-B radiation
18270339 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17150533 The enzymatic reactions with human DNA polymerase eta on oxidative products of guanine and 8-oxoG, is investigated.
16835218 Human DNA polymerase eta selectively produces a two-base deletion in copying the N2-guanyl adduct of 2-amino-3-methylimidazo[4,5-f]quinoline but not the C8 adduct at the NarI G3 site
16824193 DNA polymerase eta (Poleta) is responsible for efficient translesion synthesis (TLS) past cis-syn cyclobutane thymine dimers (TT dimers), the major DNA lesions induced by UV irradiation.
16603639 Pol eta can play an important role in determining the cellular sensitivity to therapeutic agents.
16520097 The results demonstrate that activation of a UV-induced DNA damage response pathway, involving phosphorylation of RPA p34 by DNA-PK, is enhanced in cells lacking poleta.
16188888 analysis of human DNA polymerase eta error-prone synthesis on DNA deoxyadenosine adducts
15496986 POLQ has a high efficiency in by-passing DNA damage.
14735462 DNA Pol theta has a specialized function in lymphocytes and in tumor progression
14576298 the isolation of the full-length human DNA POLQ gene, and an initial characterization of its gene product, DNA polymerase theta
12051913 DNA polymerase theta purified from human cells is a high-fidelity enzyme.

AA Sequence

MNLLRRSGKRRRSESGSDSFSGSGGDSSASPQFLSGSVLSPPPGLGRCLKAAAAGECKPTVPDYERDKLL      1 - 70
LANWGLPKAVLEKYHSFGVKKMFEWQAECLLLGQVLEGKNLVYSAPTSAGKTLVAELLILKRVLEMRKKA     71 - 140
LFILPFVSVAKEKKYYLQSLFQEVGIKVDGYMGSTSPSRHFSSLDIAVCTIERANGLINRLIEENKMDLL    141 - 210
GMVVVDELHMLGDSHRGYLLELLLTKICYITRKSASCQADLASSLSNAVQIVGMSATLPNLELVASWLNA    211 - 280
ELYHTDFRPVPLLESVKVGNSIYDSSMKLVREFEPMLQVKGDEDHVVSLCYETICDNHSVLLFCPSKKWC    281 - 350
EKLADIIAREFYNLHHQAEGLVKPSECPPVILEQKELLEVMDQLRRLPSGLDSVLQKTVPWGVAFHHAGL    351 - 420
TFEERDIIEGAFRQGLIRVLAATSTLSSGVNLPARRVIIRTPIFGGRPLDILTYKQMVGRAGRKGVDTVG    421 - 490
ESILICKNSEKSKGIALLQGSLKPVRSCLQRREGEEVTGSMIRAILEIIVGGVASTSQDMHTYAACTFLA    491 - 560
ASMKEGKQGIQRNQESVQLGAIEACVMWLLENEFIQSTEASDGTEGKVYHPTHLGSATLSSSLSPADTLD    561 - 630
IFADLQRAMKGFVLENDLHILYLVTPMFEDWTTIDWYRFFCLWEKLPTSMKRVAELVGVEEGFLARCVKG    631 - 700
KVVARTERQHRQMAIHKRFFTSLVLLDLISEVPLREINQKYGCNRGQIQSLQQSAAVYAGMITVFSNRLG    701 - 770
WHNMELLLSQFQKRLTFGIQRELCDLVRVSLLNAQRARVLYASGFHTVADLARANIVEVEVILKNAVPFK    771 - 840
SARKAVDEEEEAVEERRNMRTIWVTGRKGLTEREAAALIVEEARMILQQDLVEMGVQWNPCALLHSSTCS    841 - 910
LTHSESEVKEHTFISQTKSSYKKLTSKNKSNTIFSDSYIKHSPNIVQDLNKSREHTSSFNCNFQNGNQEH    911 - 980
QTCSIFRARKRASLDINKEKPGASQNEGKTSDKKVVQTFSQKTKKAPLNFNSEKMSRSFRSWKRRKHLKR    981 - 1050
SRDSSPLKDSGACRIHLQGQTLSNPSLCEDPFTLDEKKTEFRNSGPFAKNVSLSGKEKDNKTSFPLQIKQ   1051 - 1120
NCSWNITLTNDNFVEHIVTGSQSKNVTCQATSVVSEKGRGVAVEAEKINEVLIQNGSKNQNVYMKHHDIH   1121 - 1190
PINQYLRKQSHEQTSTITKQKNIIERQMPCEAVSSYINRDSNVTINCERIKLNTEENKPSHFQALGDDIS   1191 - 1260
RTVIPSEVLPSAGAFSKSEGQHENFLNISRLQEKTGTYTTNKTKNNHVSDLGLVLCDFEDSFYLDTQSEK   1261 - 1330
IIQQMATENAKLGAKDTNLAAGIMQKSLVQQNSMNSFQKECHIPFPAEQHPLGATKIDHLDLKTVGTMKQ   1331 - 1400
SSDSHGVDILTPESPIFHSPILLEENGLFLKKNEVSVTDSQLNSFLQGYQTQETVKPVILLIPQKRTPTG   1401 - 1470
VEGECLPVPETSLNMSDSLLFDSFSDDYLVKEQLPDMQMKEPLPSEVTSNHFSDSLCLQEDLIKKSNVNE   1471 - 1540
NQDTHQQLTCSNDESIIFSEMDSVQMVEALDNVDIFPVQEKNHTVVSPRALELSDPVLDEHHQGDQDGGD   1541 - 1610
QDERAEKSKLTGTRQNHSFIWSGASFDLSPGLQRILDKVSSPLENEKLKSMTINFSSLNRKNTELNEEQE   1611 - 1680
VISNLETKQVQGISFSSNNEVKSKIEMLENNANHDETSSLLPRKESNIVDDNGLIPPTPIPTSASKLTFP   1681 - 1750
GILETPVNPWKTNNVLQPGESYLFGSPSDIKNHDLSPGSRNGFKDNSPISDTSFSLQLSQDGLQLTPASS   1751 - 1820
SSESLSIIDVASDQNLFQTFIKEWRCKKRFSISLACEKIRSLTSSKTATIGSRFKQASSPQEIPIRDDGF   1821 - 1890
PIKGCDDTLVVGLAVCWGGRDAYYFSLQKEQKHSEISASLVPPSLDPSLTLKDRMWYLQSCLRKESDKEC   1891 - 1960
SVVIYDFIQSYKILLLSCGISLEQSYEDPKVACWLLDPDSQEPTLHSIVTSFLPHELPLLEGMETSQGIQ   1961 - 2030
SLGLNAGSEHSGRYRASVESILIFNSMNQLNSLLQKENLQDVFRKVEMPSQYCLALLELNGIGFSTAECE   2031 - 2100
SQKHIMQAKLDAIETQAYQLAGHSFSFTSSDDIAEVLFLELKLPPNREMKNQGSKKTLGSTRRGIDNGRK   2101 - 2170
LRLGRQFSTSKDVLNKLKALHPLPGLILEWRRITNAITKVVFPLQREKCLNPFLGMERIYPVSQSHTATG   2171 - 2240
RITFTEPNIQNVPRDFEIKMPTLVGESPPSQAVGKGLLPMGRGKYKKGFSVNPRCQAQMEERAADRGMPF   2241 - 2310
SISMRHAFVPFPGGSILAADYSQLELRILAHLSHDRRLIQVLNTGADVFRSIAAEWKMIEPESVGDDLRQ   2311 - 2380
QAKQICYGIIYGMGAKSLGEQMGIKENDAACYIDSFKSRYTGINQFMTETVKNCKRDGFVQTILGRRRYL   2381 - 2450
PGIKDNNPYRKAHAERQAINTIVQGSAADIVKIATVNIQKQLETFHSTFKSHGHREGMLQSDQTGLSRKR   2451 - 2520
KLQGMFCPIRGGFFILQLHDELLYEVAEEDVVQVAQIVKNEMESAVKLSVKLKVKVKIGASWGELKDFDV   2521 - 2590
//

Text Mined References (36)

PMID Year Title
25775267 2015 Human DNA polymerase ? grasps the primer terminus to mediate DNA repair.
25643323 2015 Mechanism of microhomology-mediated end-joining promoted by human DNA polymerase ?.
25642963 2015 Homologous-recombination-deficient tumours are dependent on Pol?-mediated repair.
25642960 2015 Mammalian polymerase ? promotes alternative NHEJ and suppresses recombination.
25417172 2015 Single-nucleotide polymorphisms in DNA bypass polymerase genes and association with breast cancer and breast cancer subtypes among African Americans and Whites.
25409685 2014 A DNA repair variant in POLQ (c.-1060A > G) is associated to hereditary breast cancer patients: a case-control study.
24989122 2014 A role for DNA polymerase ? in the timing of DNA replication.
24648516 2014 A role for DNA polymerase ? in promoting replication through oxidative DNA lesion, thymine glycol, in human cells.
23577232 2013 Stepwise assembly of the human replicative polymerase holoenzyme.
23502783 2013 The CCND1 c.870G>A polymorphism is a risk factor for t(11;14)(q13;q32) multiple myeloma.
23223146 2013 A genome-wide association study in Caucasian women points out a putative role of the STXBP5L gene in facial photoaging.
22135286 2012 Promiscuous DNA synthesis by human DNA polymerase ?.
21050863 2011 Lesion bypass activity of DNA polymerase ? (POLQ) is an intrinsic property of the pol domain and depends on unique sequence inserts.
20700469 2010 Overexpression of POLQ confers a poor prognosis in early breast cancer patients.
20624954 2010 DNA polymerase theta up-regulation is associated with poor survival in breast cancer, perturbs DNA replication, and promotes genetic instability.
19661089 2009 Genetic variation in immune regulation and DNA repair pathways and stomach cancer in China.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
19188258 2009 Human DNA polymerase theta possesses 5'-dRP lyase activity and functions in single-nucleotide base excision repair in vitro.
18503084 2008 Low-fidelity DNA synthesis by human DNA polymerase theta.
18366182 2008 Biochemical evolution of DNA polymerase eta: properties of plant, human, and yeast proteins.
18270339 2008 Comprehensive analysis of DNA repair gene variants and risk of meningioma.
17150533 2004 Translesion synthesis by human DNA polymerase eta across oxidative products of guanine.
16835218 2006 Biochemical basis of genotoxicity of heterocyclic arylamine food mutagens: Human DNA polymerase eta selectively produces a two-base deletion in copying the N2-guanyl adduct of 2-amino-3-methylimidazo[4,5-f]quinoline but not the C8 adduct at the NarI G3 site.
16824193 2006 A human DNA polymerase eta complex containing Rad18, Rad6 and Rev1; proteomic analysis and targeting of the complex to the chromatin-bound fraction of cells undergoing replication fork arrest.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16603639 2006 A novel role of DNA polymerase eta in modulating cellular sensitivity to chemotherapeutic agents.
16520097 2006 UV-induced RPA phosphorylation is increased in the absence of DNA polymerase eta and requires DNA-PK.
16222339 2005 The translesion DNA polymerase theta plays a dominant role in immunoglobulin gene somatic hypermutation.
16188888 2005 Error-prone translesion synthesis by human DNA polymerase eta on DNA-containing deoxyadenosine adducts of 7,8-dihydroxy-9,10-epoxy-7,8,9,10-tetrahydrobenzo[a]pyrene.
15496986 2004 High-efficiency bypass of DNA damage by human DNA polymerase Q.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14735462 2004 DNA polymerase theta is preferentially expressed in lymphoid tissues and upregulated in human cancers.
14576298 2003 POLQ (Pol theta), a DNA polymerase and DNA-dependent ATPase in human cells.
10395804 1999 Cloning and chromosomal mapping of the human DNA polymerase theta (POLQ), the eighth human DNA polymerase.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.