Property Summary

NCBI Gene PubMed Count 89
PubMed Score 1701.88
PubTator Score 597.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma 1.200 5.1e-08
gastric cancer 1.200 1.4e-03
glioblastoma multiforme 1.100 8.2e-16
hepatocellular carcinoma 1.100 1.0e-05
invasive ductal carcinoma -1.400 6.5e-03
malignant mesothelioma -1.800 2.0e-07
osteosarcoma -1.918 1.2e-03
ovarian cancer -2.300 1.2e-13
progressive supranuclear palsy -1.400 1.4e-02
psoriasis -1.300 3.8e-06

Gene RIF (57)

AA Sequence

MEKLGVEPEEEGGGDDDEEDAEAWAMELADVGAAASSQGVHDQVLPTPNASSRVIVHVDLDCFYAQVEMI      1 - 70
SNPELKDKPLGVQQKYLVVTCNYEARKLGVKKLMNVRDAKEKCPQLVLVNGEDLTRYREMSYKVTELLEE     71 - 140
FSPVVERLGFDENFVDLTEMVEKRLQQLQSDELSAVTVSGHVYNNQSINLLDVLHIRLLVGSQIAAEMRE    141 - 210
AMYNQLGLTGCAGVASNKLLAKLVSGVFKPNQQTVLLPESCQHLIHSLNHIKEIPGIGYKTAKCLEALGI    211 - 280
NSVRDLQTFSPKILEKELGISVAQRIQKLSFGEDNSPVILSGPPQSFSEEDSFKKCSSEVEAKNKIEELL    281 - 350
ASLLNRVCQDGRKPHTVRLIIRRYSSEKHYGRESRQCPIPSHVIQKLGTGNYDVMTPMVDILMKLFRNMV    351 - 420
NVKMPFHLTLLSVCFCNLKALNTAKKGLIDYYLMPSLSTTSRSGKHSFKMKDTHMEDFPKDKETNRDFLP    421 - 490
SGRIESTRTRESPLDTTNFSKEKDINEFPLCSLPEGVDQEVFKQLPVDIQEEILSGKSREKFQGKGSVSC    491 - 560
PLHASRGVLSFFSKKQMQDIPINPRDHLSSSKQVSSVSPCEPGTSGFNSSSSSYMSSQKDYSYYLDNRLK    561 - 630
DERISQGPKEPQGFHFTNSNPAVSAFHSFPNLQSEQLFSRNHTTDSHKQTVATDSHEGLTENREPDSVDE    631 - 700
KITFPSDIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK                                  701 - 740
//

Text Mined References (90)

PMID Year Title