Property Summary

NCBI Gene PubMed Count 138
PubMed Score 200.29
PubTator Score 116.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia 1.300 2.2e-02
adult high grade glioma 1.100 1.6e-03
Breast cancer 2.500 3.7e-02
group 3 medulloblastoma 1.400 2.1e-03
osteosarcoma 1.800 2.5e-05
tuberculosis and treatment for 6 months -1.100 2.0e-04

 GO Component (2)

Protein-protein Interaction (5)

PDB (115)

Gene RIF (118)

AA Sequence

MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKK      1 - 70
LCPDLLLAQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISAD     71 - 140
LLPSTYIEGLPQGPTTAEETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGF    141 - 210
QCSAGISHNKVLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQ    211 - 280
FTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLAQELEE    281 - 350
RLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAFTVIKNCNTSGIQTEWSPPLT    351 - 420
MLFLCATKFSASAPSSSTDITSFLSSDPSSLPKVPVTSSEAKTQGSGPAVTATKKATTSLESFFQKAAER    421 - 490
QKVKEASLSSLTAPTQAPMSNSPSKPSLPFQTSQSTGTEPFFKQKSLLLKQKQLNNSSVSSPQQNPWSNC    491 - 560
KALPNSLPTEYPGCVPVCEGVSKLEESSKATPAEMDLAHNSQSMHASSASKSVLEVTQKATPNPSLLAAE    561 - 630
DQVPCEKCGSLVPVWDMPEHMDYHFALELQKSFLQPHSSNPQVVSAVSHQGKRNPKSPLACTNKRPRPEG    631 - 700
MQTLESFFKPLTH                                                             701 - 713
//

Text Mined References (140)

PMID Year Title