Property Summary

NCBI Gene PubMed Count 125
PubMed Score 336.55
PubTator Score 116.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.800 2.5e-05
tuberculosis and treatment for 6 months -1.100 2.0e-04
Breast cancer 2.500 3.7e-02
adult high grade glioma 1.100 1.6e-03
group 3 medulloblastoma 1.500 1.1e-04
acute myeloid leukemia 1.300 2.2e-02

Synonym

Accession Q9Y253 Q7L8E3 Q96BC4 Q9BX13
Symbols XPV
XP-V
RAD30
RAD30A

Gene

PDB

2LSK   2I5O   3JAA   3MR2   3MR3   3MR5   3MR6   3SI8   3TQ1   3WUP   4DL2   4DL3   4DL4   4DL5   4DL6   4DL7   4ECQ   4ECR   4ECS   4ECT   4ECU   4ECV   4ECW   4ECX   4ECY   4ECZ   4ED0   4ED1   4ED2   4ED3   4ED6   4ED7   4ED8   4EEY   4J9K   4J9L   4J9M   4J9N   4J9O   4J9P   4J9Q   4J9R   4J9S   4O3N   4O3O   4O3P   4O3Q   4O3R   4O3S   4Q8E   4Q8F   4RNM   4RNN   4RNO   4RU9   4YP3   4YQW   4YR0   4YR2   4YR3   5DG7   5DG8   5DG9   5DGA   5DGB   5DLF   5DLG   5DQG   5DQH   5DQI   5EWE   5EWF   5EWG   5JUM   5KFA   5KFB   5KFC   5KFD   5KFE   5KFF   5KFG   5KFH   5KFI   5KFJ   5KFK   5KFL   5KFM   5KFN   5KFO   5KFP   5KFQ   5KFR   5KFS   5KFT   5KFU   5KFV   5KFW   5KFX   5KFY   5KFZ   5KG0   5KG1   5KG2   5KG3   5KG4   5KG5   5KG6   5KG7   5L9X  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (2)

Protein-protein Interaction (14)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
588591 confirmatory 4746 / 13893 / 373704 qHTS for Inhibitors of Polymerase Eta
588636 summary 0 / 0 / 0 qHTS for Inhibitors of Polymerase Eta: Summary
720502 confirmatory 1696 / 942 / 0 qHTS for Inhibitors of Polymerase Eta: Confirmatory Assay for Cherry-picked Compounds

Gene RIF (105)

PMID Text
26935581 The described is cooperative motion of a key positively charged residue and metal ions for DNA replication catalyzed by human DNA Polymerase eta.
26434497 free energy difference is slightly greater for binding at the 5' thymine position than at the 3' thymine position, presumably because of stabilization arising from the A:T base pair formed at the 3' position of the TTD in previous step of Pol eta function
26170230 Poleta has three PCNA-interacting protein (PIP) boxes (PIP1, 2, 3) that contribute differentially to two distinct functions, stimulation of DNA synthesis and promotion of PCNA ubiquitination.
25947374 Arg-61 and Gln-38 of human DNA polymerase (hpol) eta play important roles in the catalytic reaction.
25831546 ovarian CSCs have intrinsically enhanced Pol eta-mediated translesion DNA synthesis, allowing CSCs to survive cisplatin treatment, leading to tumor relapse
25766642 PolH721 variant present in XP-V patients is unstable. Extra 8 amino acids of PolH721 do not act as degron but induce conformational change of PolH C-terminus exposing its bipartite NLS and sequence close to its UBZ to the ubiquitin/proteasome system.
25666608 Human pol eta, a major copying enzyme with abasic sites, follows a purine rule, which can also lead to frameshifts. The phenomenon can be explained with H-bonds.
25662213 The results show that the FF483-484 amino acids in the human Poleta (designated F1 motif) are necessary for the interaction of this polymerase with POLD2, the B subunit of the replicative DNA polymerase delta, both in vitro and in vivo.
25435364 our findings reveal a modulatory role of USP7 in PCNA ubiquitination-mediated stress-tolerance pathways by fine-tuning Poleta turnover.
25268038 A novel mechanism by which POLH expression is controlled by PCBP1 via mRNA stability.
25139235 results suggest that WRNIP1 functions upstream of Poleta in the response to UV irradiation
25080294 The molecular mechanism of 3-nitrobenzanthrone genotoxicity in HEK293 cells is reported.
24877075 mutation POLH NG_009252.1: g.36847_40771del3925 is caused by an equal crossover event that occurred between two homologous chromosomes at meiosis.
24716551 time-resolved X-ray crystallographic study of the DNA synthesis reaction catalyzed by the Y-Family DNA polymerase human polymerase eta revealed transient elements that led to the nucleotidyl-transfer reaction[review]
24553286 observed enhanced ubiquitylation of Poleta by TRIP E3 ligase and show that TRIP promotes Poleta localization to nuclear foci
24485656 PALB2 and BRCA2, in addition to their functions in D loop formation, play crucial roles in the initiation of recombination-associated DNA synthesis by Poleta-mediated DNA repair.
24449906 Human Pol eta inserts a nucleotide opposite the lesion, followed by Pol zeta extending the DNA primer; thus, the two complement each other to fully bypass the cisplatin cross-link.
24130121 DNA sequencing of POLH in Xeroderma pigmentosum variant patients revealed many mutations leading to truncated polymerases in 69% of them. Also, there is a clear relationship between the types of missense mutations and clinical severity.
23965998 Human Pol iota and yeast Pol zeta complex could function efficiently in the insertion and extension steps, respectively, of ranslesion synthesis and human Pol kappa and Pol eta could also extend past these lesions, albeit much less efficiently.
23913529 Mutational analysis of the little finger domain in human DNA polymerase eta confirm the importance of the beta-strand in polymerase function and show that fidelity is most often altered when undamaged DNA is copied.
23761444 Poleta is dispensable for DNA-damage tolerance.
23731732 Pol eta and Pol kappa are involved in redundant pathways for homologous recombination.
23630442 homozygous c.67C>T mutation in the exon 2 of DNA polymerase eta (POLH), a novel non-sense mutation in POLH, was discovered
23630267 human DNA polymerase eta has a role in somatic hypermutation of Ig at the WA motif
23609533 Dna polymerase eta is required for DNA synthesis during S phase at replication forks stalled in common fragile sites (CFS) regions to suppress CFS instability.
23499771 amino acids Q38, Y52, and R61 play key roles in determining DNA polymerase eta function
23388460 In the early phase of DNA damage response, FANCD2 plays crucial roles in recruiting pol eta to the sites of DNA damage for repair.
23345618 a novel non-catalytic role for POLH in promoting PCNA monoubiquitination.
23248005 Results show that the physical and functional interaction between pols eta and iota occurs between ubiquitinated forms of either polymerase via their respective ubiquitin-binding domains.
23033487 GCN5 takes part in transcription regulation of POLH gene through alterations in the chromatin structure by direct interaction with its 5'-flanking region, and protects vertebrate cells against UV-induced DNA damage via controlling POLH gene expression.
22989887 the ubiquitin moiety is flexible relative to the PCNA, with its hydrophobic patch mostly accessible for recruitment of TLS polymerases, which promotes the interaction with polymerase eta
22981619 DNA polymerase eta plays an important role in the response of L-02 (liver) cells the hydroquinone-induced DNA damage.
22828282 the Rev1 C-terminal domain utilizes independent interaction interfaces to simultaneously bind a fragment of the 'inserter' poleta and Rev7 subunit of the 'extender' polvarsigma, thereby serving as a cassette that may accommodate several polymerases
22691049 a structural basis for understanding the recognition of the Rev1-CT by Y-family DNA polymerases
22529383 Data show that to incorporate deoxycytidine opposite cisplatin-cross-linked guanines, DNA polymerase eta (hPol eta) undergoes a specific backbone rearrangement to accommodate the larger base dimer and minimizes the DNA distortion around the lesion.
22456510 Ser409, located within the pol-eta binding domain of Rad18, is phosphorylated by c-jun kinase in response to dna damage, promoting the interaction between Rad18 and pol-eta.
22367195 We propose that IRF1 activation is responsible for carcinogen-induced Poleta up-regulation, which contributes to mutagenesis and ultimately carcinogenesis in cells.
22154937 The rate-limiting conformational change step in the Poleta replication cycle likely corresponds to a rate-limiting entry of catalytic metals in the active site.
22056306 Mdm2 physically associates with PolH and promotes PolH polyubiquitination in vivo and in vitro
21855803 Poleta interacts with mUb-PCNA at sites of oxidative DNA damage via its PCNA-binding and ubiquitin-binding motifs.
21704031 Studies indicate that All the Y-family polymerases have ubiquitin binding domains that bind to mono-ubiquitinated PCNA to effect the switching from replicative to Y-family polymerase.
21640722 A genetically inherited deletion within DNA polymerase eta, is detected.
21242293 DNA damage-induced phosphorylation of DNA polymerase eta depends on its physical interaction with Rad18 but is independent of PCNA monoubiquitination.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20577208 crystal structures of human Poleta at four consecutive steps during DNA synthesis through cis-syn cyclobutane thymine dimers
20498091 show that the two C-terminally deleted DNA polymerase eta proteins (1-475) and (1-555) that contain the PCNA-interacting protein domain complement the UV sensitivity of XPV cells.
20457011 this work postulates that loss of either functional pol eta engenders abnormal persistence of stalled replication forks at UV-adducted sites in DNA.
20215648 Contributions of nucleotide excision repair, DNA polymerase eta, and homologous recombination to replication of UV-irradiated herpes simplex virus type 1.
20173781 Targeting the FANCJ-BRCA1 interaction promotes a switch from recombination to poleta-dependent bypass.
20159558 Monoubiquitination of Polymerase eta masks its PCNA-interacting region.
20064529 The authors obtained direct evidence that polymerase switching reactions are stimulated by mono-ubiquitination of PCNA, depending on a function of the ubiquitin binding zinc finger domain of pol eta.
20028736 REV1 and Polzeta facilitate repair of interstrand cross-links independently of PCNA monoubiquitination and Poleta, whereas RAD18 plus Poleta, REV1, and Polzeta are all necessary for replicative bypass of cisplatin intrastrand DNA cross-links.
20008555 found that PolH is recruited by Pirh2 and degraded by 20S proteasome in a ubiquitin-independent manner.
19939936 results suggested that amino acids at distinct positions in the active sites of Poleta and Polkappa might enhance 8-oxo-dGTP to favor the syn conformation, and thus direct its misincorporation into DNA.
19822754 observe upon the simultaneous knockdown of Pols kappa and zeta implicates a highly error-free role of Poleta in TLS opposite cyclobutane pyrimidine dimers in mammalian cells.
19806028 The re-localization of the polymerase (DNA directed) eta to photo-lesions might be temporally and mechanistically uncoupled from replicative DNA synthesis and from DNA damage processing.
19703417 Co-immunoprecipitation analyses revealed that MutLalpha, and also MSH2 and MSH6, components of the MutSalpha heterodimer, form complexes with Poleta in human cells.
19661089 Observational study of gene-disease association. (HuGE Navigator)
19477635 the c.1783G, p.595V allele was statistically associated with melanoma (respective allelic frequencies, 0.040 versus 0.022, P-value=1.17 x 10(-3), odds ratio (OR)=1.86 [1.27-2.71]), which was further confirmed by a meta-analysis
19477635 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19380493 short hairpin RNA-mediated depletion of Pol eta from undamaged cells affects cell cycle progression and the rate of cell proliferation and results in increased spontaneous chromosome breaks and common fragile site expression
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19157994 Poleta-REV1 interactions prevent spontaneous mutations, probably by promoting accurate translesion DNA synthesis past endogenous DNA lesions
19117014 Downregulation of DNA polymerases eta is associated with colorectal-adenocarcinomas.
19108641 Translesional DNA synthesis by POLH on templates containing a pyrimidopurinone deoxyguanosine adduct is reported.
19069642 Hydroquinone could induce the expression of XPV in a dose- and time-dependent manner in L-02 hepatic cells.
19001268 The binding to PCNA via its PIP domain is a prerequisite for Poleta's ability to function in translesion synthesis in human cells.
18946034 phosphorylation of pol eta increased after UV irradiation, and treatment with caffeine, siRNA against ATR, or an inhibitor of PKC, reduced the accumulation of pol eta at stalled replication forks after UV irradiation
18799611 Data suggest that DNA polymerases eta and iota transiently probe DNA/chromatin; when DNA is exposed at replication forks, the polymerase residence times increase, and this is further facilitated by the ubiquitination of PCNA.
18703314 Four types of possible founder mutations of POLH are responsible for 87% of Japanese patients with Xeroderma pigmentosum variant type.
18634905 These results highlight the critical role of poleta in error-free translesion DNA synthesis across thymine-thymine cyclobutane pyrimidine dimer in human cells.
18512958 Data show that showed that pol kappaDeltaC was more efficient than pol eta by incorporating dCMP opposite both 6alpha- and 6beta-isomeric dG-N(2)-6-E(2) adducts.
18368133 There is a wide spectrum of mutations in the POLH gene among xeroderma pigmentosum-variant patients in different countries, suggesting that many of these mutations arose independently.
18321066 PCNA ubiquitylation at K164 of PCNA is not required in vitro for DNA polymerase eta to gain access to replication complexes at forks stalled by T (wedge)T and to catalyze translesion synthesis across this dimer
18242151 findings suggest that Poleta may be involved in induction of various types of mutations through the erroneous and efficient incorporation of oxidized dNTPs into DNA in human cells
18068156 Results are consistent with a model in which nucleotide excision repair and polymerase eta are are involved in processing crosslinks and avoiding gamma-H2AX associated with double-strand breaks and single-stranded DNA in human cells.
17344931 The immunoprecipitation analysis of the POLH protein revealed a very useful method for screening the patients suspected of xeroderma pigmentosum variant type. Seven mutations in the POLH gene including three novel mutations were identified.
17334634 Differences in gene expression, rather than sequence changes may be the main mechanism by which POLH status varies between normal and skin tumours in the population under investigation.
16823845 Neither mutations nor polymorphisms in the coding regions of POLH are required for the generation of human skin squamous cell carcinoma.
16763556 DNA polymerases iota and eta interact noncovalently with free polyUb chains, as well as mono-ubiquitinated proliferating cell nuclear antigen (Ub-PCNA).
16675950 Data show that ultraviolet (UV) radiation-induced ATR signaling is compromised in XPA-deficient human cells during S phase, and this signaling involves UV bypass polymerase eta.
16449651 PolH has a novel role in the DNA damage checkpoint, and a p53 target can modulate the DNA damage response and subsequently regulate p53 activation.
16357261 identification of two previously unknown ubiquitin-binding domains in the Y-family translesion synthesis polymerases that enable them to interact with monoubiquitinated targets and undergo monoubiquitination in vivo
16116089 incorporates dATP opposite the 5' T of the cyclobutane pyrimidine dimers via Watson-Crick base pairing and not by Hoogsteen base pairing
16061253 Data suggest that DNA polymerase eta may be required for the efficient bypass of some bulky pol delta-blocking N2-guanine adducts in human cells.
15758026 High mobility of flap endonuclease 1 and DNA polymerase eta associated with replication foci in S-phase nucleus.
15569147 Catalyses translesion synthesis past cis-syn cyclobutane thymine dimers.
15380106 REV1 interacts with pol eta in translesion synthesis of damaged DNA
15149598 Monoubiquitinated PCNA but not unmodified PCNA specifically interacts with poleta, and we have identified two motifs in poleta that are involved in this interaction.
15147214 Data suggest that the properties of DNA polymerases eta and kappa are consistent with the mutagenic events attributed to estrogen-derived DNA adducts.
15051760 C is preferentially mutated in vivo and pol eta generates hypermutation in the mu and gamma switch regions.
14999287 Pol eta bypasses a dimer with low fidelity and with higher error rates at the 3' thymine than at the 5' thymine
14734526 by analyzing switched memory B cells from two xeroderma pigmentosum variant patients, pol eta is an A/T mutator during class switch recombination
14585988 mechanistic basis of the low level of fidelity of human Poleta
14523013 study of efficiency and specificity of apurinic/apyrimidinic site bypass by human DNA polymerase eta
12644471 results clearly show the protective role of DNA polymerase eta against UV-induced lesions and the activation by UV of DNA polymerase eta-independent mutagenic processes
12644469 demonstration that an amino acid substitution within the active site enhances the fidelity of DNA synthesis by human DNA polymerase eta supports the hypothesis that even error-prone DNA polymerases function in base selection
12584190 DNA polymerase eta has a role in error-prone DNA synthesis in human cells
12509472 DNA polymerase eta is involved in transcription-coupled nucleotide excision repair
12426396 DNA polymerase eta targets DNA polymerase iota to the replication machinery.
12244178 Mutational analysis of nonproductive rearrangements from a patient with xeroderma pigmentosum variant finds that the contribution of defective pol eta to overall somatic hypermutation is not essential.
11994004 Translesion synthesis by human DNA polymerase eta across thymine glycol lesions.
11821420 Preferential misincorporation of purine nucleotides by human DNA polymerase eta opposite benzo[a]pyrene 7,8-diol 9,10-epoxide deoxyguanosine adducts
11756691 These results show that XPV cells develop DNA DSBs during the course of UV-induced replication arrest
11554790 DNA polymerase fidelity and specificity

AA Sequence

MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKK      1 - 70
LCPDLLLAQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISAD     71 - 140
LLPSTYIEGLPQGPTTAEETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGF    141 - 210
QCSAGISHNKVLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQ    211 - 280
FTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLAQELEE    281 - 350
RLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAFTVIKNCNTSGIQTEWSPPLT    351 - 420
MLFLCATKFSASAPSSSTDITSFLSSDPSSLPKVPVTSSEAKTQGSGPAVTATKKATTSLESFFQKAAER    421 - 490
QKVKEASLSSLTAPTQAPMSNSPSKPSLPFQTSQSTGTEPFFKQKSLLLKQKQLNNSSVSSPQQNPWSNC    491 - 560
KALPNSLPTEYPGCVPVCEGVSKLEESSKATPAEMDLAHNSQSMHASSASKSVLEVTQKATPNPSLLAAE    561 - 630
DQVPCEKCGSLVPVWDMPEHMDYHFALELQKSFLQPHSSNPQVVSAVSHQGKRNPKSPLACTNKRPRPEG    631 - 700
MQTLESFFKPLTH                                                             701 - 713
//

Text Mined References (126)

PMID Year Title
26935581 2016 Cooperative motion of a key positively charged residue and metal ions for DNA replication catalyzed by human DNA Polymerase-?.
26434497 2015 Relative Binding Free Energies of Adenine and Guanine to Damaged and Undamaged DNA in Human DNA Polymerase ?: Clues for Fidelity and Overall Efficiency.
26170230 2015 Different types of interaction between PCNA and PIP boxes contribute to distinct cellular functions of Y-family DNA polymerases.
25947374 2015 Roles of Residues Arg-61 and Gln-38 of Human DNA Polymerase ? in Bypass of Deoxyguanosine and 7,8-Dihydro-8-oxo-2'-deoxyguanosine.
25831546 2015 Enhanced expression of DNA polymerase eta contributes to cisplatin resistance of ovarian cancer stem cells.
25766642 2015 Aberrant C-terminal domain of polymerase ? targets the functional enzyme to the proteosomal degradation pathway.
25666608 2015 Structural and kinetic analysis of nucleoside triphosphate incorporation opposite an abasic site by human translesion DNA polymerase ?.
25662213 2015 FF483-484 motif of human Pol? mediates its interaction with the POLD2 subunit of Pol? and contributes to DNA damage tolerance.
25435364 2015 USP7 modulates UV-induced PCNA monoubiquitination by regulating DNA polymerase eta stability.
25268038 2014 DNA polymerase ? is regulated by poly(rC)-binding protein 1 via mRNA stability.
25139235 2014 WRNIP1 functions upstream of DNA polymerase ? in the UV-induced DNA damage response.
25080294 2014 Mutational analysis of the C8-guanine adduct of the environmental carcinogen 3-nitrobenzanthrone in human cells: critical roles of DNA polymerases ? and ? and Rev1 in error-prone translesion synthesis.
24877075 2014 A founder large deletion mutation in Xeroderma pigmentosum-Variant form in Tunisia: implication for molecular diagnosis and therapy.
24716551 2014 An overview of Y-Family DNA polymerases and a case study of human DNA polymerase ?.
24553286 2014 TRIP/NOPO E3 ubiquitin ligase promotes ubiquitylation of DNA polymerase ?.
24485656 2014 Breast cancer proteins PALB2 and BRCA2 stimulate polymerase ? in recombination-associated DNA synthesis at blocked replication forks.
24449906 2014 Human Pol ? purified with accessory subunits is active in translesion DNA synthesis and complements Pol ? in cisplatin bypass.
24130121 2014 Correlation of phenotype/genotype in a cohort of 23 xeroderma pigmentosum-variant patients reveals 12 new disease-causing POLH mutations.
23965998 2013 Translesion synthesis of 8,5'-cyclopurine-2'-deoxynucleosides by DNA polymerases ?, ?, and ?.
23913529 2013 Mutation of the little finger domain in human DNA polymerase ? alters fidelity when copying undamaged DNA.
23761444 2013 DNA-damage tolerance mediated by PCNA*Ub fusions in human cells is dependent on Rev1 but not Pol?.
23731732 2013 Role of PCNA and TLS polymerases in D-loop extension during homologous recombination in humans.
23630442 2013 Identification of a novel nonsense mutation in POLH in a Chinese pedigree with xeroderma pigmentosum, variant type.
23630267 2013 Mechanism of somatic hypermutation at the WA motif by human DNA polymerase ?.
23609533 2013 DNA synthesis by Pol ? promotes fragile site stability by preventing under-replicated DNA in mitosis.
23499771 Biochemical analysis of active site mutations of human polymerase ?.
23388460 2013 Recruitment of DNA polymerase eta by FANCD2 in the early response to DNA damage.
23345618 2013 A non-catalytic role of DNA polymerase ? in recruiting Rad18 and promoting PCNA monoubiquitination at stalled replication forks.
23248005 2013 Ubiquitin mediates the physical and functional interaction between human DNA polymerases ? and ?.
23033487 2012 GCN5 protects vertebrate cells against UV-irradiation via controlling gene expression of DNA polymerase ?.
22989887 2012 Intrinsic flexibility of ubiquitin on proliferating cell nuclear antigen (PCNA) in translesion synthesis.
22981619 2012 Down-regulation of Pol? expression leads to increased DNA damage, apoptosis and enhanced S phase arrest in L-02 cells exposed to hydroquinone.
22828282 2012 The C-terminal domain of human Rev1 contains independent binding sites for DNA polymerase ? and Rev7 subunit of polymerase ?.
22691049 2012 NMR structure and dynamics of the C-terminal domain from human Rev1 and its complex with Rev1 interacting region of DNA polymerase ?.
22529383 2012 Structural basis of human DNA polymerase ?-mediated chemoresistance to cisplatin.
22456510 2012 c-Jun N-terminal kinase-mediated Rad18 phosphorylation facilitates Pol? recruitment to stalled replication forks.
22367195 2012 Interferon regulatory factor 1 transactivates expression of human DNA polymerase ? in response to carcinogen N-methyl-N'-nitro-N-nitrosoguanidine.
22154937 2012 Human DNA polymerase ? is pre-aligned for dNTP binding and catalysis.
22056306 2012 DNA polymerase eta is targeted by Mdm2 for polyubiquitination and proteasomal degradation in response to ultraviolet irradiation.
21855803 2011 The hMsh2-hMsh6 complex acts in concert with monoubiquitinated PCNA and Pol ? in response to oxidative DNA damage in human cells.
21791603 2011 Pirh2 E3 ubiquitin ligase monoubiquitinates DNA polymerase eta to suppress translesion DNA synthesis.
21704031 2011 Ubiquitin-family modifications in the replication of DNA damage.
21640722 2011 Xeroderma pigmentosum variant: complementary molecular approaches to detect a 13 base pair deletion in the DNA polymerase eta gene.
21242293 2011 ATR-mediated phosphorylation of DNA polymerase ? is needed for efficient recovery from UV damage.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20577208 2010 Structure and mechanism of human DNA polymerase eta.
20498091 2010 DNA polymerase eta lacking the ubiquitin-binding domain promotes replicative lesion bypass in humans cells.
20457011 2010 Requirement for functional DNA polymerase eta in genome-wide repair of UV-induced DNA damage during S phase.
20215648 2010 Contributions of nucleotide excision repair, DNA polymerase eta, and homologous recombination to replication of UV-irradiated herpes simplex virus type 1.
20173781 2010 Targeting the FANCJ-BRCA1 interaction promotes a switch from recombination to poleta-dependent bypass.
20159558 2010 Regulation of translesion synthesis DNA polymerase eta by monoubiquitination.
20064529 2010 DNA replication-coupled PCNA mono-ubiquitination and polymerase switching in a human in vitro system.
20028736 2010 Differential roles for DNA polymerases eta, zeta, and REV1 in lesion bypass of intrastrand versus interstrand DNA cross-links.
20008555 2010 Pirh2 E3 ubiquitin ligase targets DNA polymerase eta for 20S proteasomal degradation.
19939936 2010 Critical amino acids in human DNA polymerases eta and kappa involved in erroneous incorporation of oxidized nucleotides.
19822754 2009 Highly error-free role of DNA polymerase eta in the replicative bypass of UV-induced pyrimidine dimers in mouse and human cells.
19806028 2009 DNA damage induced Pol eta recruitment takes place independently of the cell cycle phase.
19703417 2009 A novel interaction between human DNA polymerase eta and MutLalpha.
19661089 2009 Genetic variation in immune regulation and DNA repair pathways and stomach cancer in China.
19477635 2009 Variants of the xeroderma pigmentosum variant gene (POLH) are associated with melanoma risk.
19380493 2009 Human DNA polymerase eta is required for common fragile site stability during unperturbed DNA replication.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
19157994 2009 Interaction with DNA polymerase eta is required for nuclear accumulation of REV1 and suppression of spontaneous mutations in human cells.
19117014 2009 Role of TLS DNA polymerases eta and kappa in processing naturally occurring structured DNA in human cells.
19108641 2009 Translesion DNA synthesis by human DNA polymerase eta on templates containing a pyrimidopurinone deoxyguanosine adduct, 3-(2'-deoxy-beta-d-erythro-pentofuranosyl)pyrimido-[1,2-a]purin-10(3H)-one.
19069642 2008 [Study on expression regularity of XPV mRNA in L-02 hepatic cells induced by hydroquinone].
19001268 2008 Roles of PCNA-binding and ubiquitin-binding domains in human DNA polymerase eta in translesion DNA synthesis.
18946034 2008 Human DNA polymerase eta activity and translocation is regulated by phosphorylation.
18799611 2008 Effect of proliferating cell nuclear antigen ubiquitination and chromatin structure on the dynamic properties of the Y-family DNA polymerases.
18703314 2008 Four types of possible founder mutations are responsible for 87% of Japanese patients with Xeroderma pigmentosum variant type.
18634905 2008 Reduced efficiency and increased mutagenicity of translesion DNA synthesis across a TT cyclobutane pyrimidine dimer, but not a TT 6-4 photoproduct, in human cells lacking DNA polymerase eta.
18512958 2008 Miscoding properties of 6alpha- and 6beta-diastereoisomers of the N(2)-(estradiol-6-yl)-2'-deoxyguanosine DNA adduct by Y-family human DNA polymerases.
18368133 2008 Xeroderma pigmentosum-variant patients from America, Europe, and Asia.
18321066 2008 Ubiquitylation of proliferating cell nuclear antigen and recruitment of human DNA polymerase eta.
18242151 2008 Specificity of mutations induced by incorporation of oxidized dNTPs into DNA by human DNA polymerase eta.
18068156 2008 DNA polymerase eta reduces the gamma-H2AX response to psoralen interstrand crosslinks in human cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17563354 2007 Werner syndrome protein interacts functionally with translesion DNA polymerases.
17344931 2007 Molecular analysis of DNA polymerase eta gene in Japanese patients diagnosed as xeroderma pigmentosum variant type.
17334634 2007 The human POLH gene is not mutated, and is expressed in a cohort of patients with basal or squamous cell carcinoma of the skin.
17304240 2007 Structure of the ubiquitin-binding zinc finger domain of human DNA Y-polymerase eta.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16823845 2006 Mutations in DNA polymerase eta are not detected in squamous cell carcinoma of the skin.
16763556 2006 Controlling the subcellular localization of DNA polymerases iota and eta via interactions with ubiquitin.
16710452 2006 Effect of DNA repair protein Rad18 on viral infection.
16675950 2006 Opposing effects of the UV lesion repair protein XPA and UV bypass polymerase eta on ATR checkpoint signaling.
16449651 2006 DNA polymerase eta, the product of the xeroderma pigmentosum variant gene and a target of p53, modulates the DNA damage checkpoint and p53 activation.
16357261 2005 Ubiquitin-binding domains in Y-family polymerases regulate translesion synthesis.
16116089 2005 Distinct mechanisms of cis-syn thymine dimer bypass by Dpo4 and DNA polymerase eta.
16061253 2005 Adduct size limits efficient and error-free bypass across bulky N2-guanine DNA lesions by human DNA polymerase eta.
15758026 2005 High mobility of flap endonuclease 1 and DNA polymerase eta associated with replication foci in mammalian S-phase nucleus.
15569147 2004 DNA binding properties of human DNA polymerase eta: implications for fidelity and polymerase switching of translesion synthesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15380106 2004 Co-localization in replication foci and interaction of human Y-family members, DNA polymerase pol eta and REVl protein.
15189446 2004 Interaction of hREV1 with three human Y-family DNA polymerases.
15149598 2004 Interaction of human DNA polymerase eta with monoubiquitinated PCNA: a possible mechanism for the polymerase switch in response to DNA damage.
15147214 2004 Translesion synthesis past estrogen-derived DNA adducts by human DNA polymerases eta and kappa.
15051760 2004 Absence of DNA polymerase eta reveals targeting of C mutations on the nontranscribed strand in immunoglobulin switch regions.
14999287 2004 Preferential cis-syn thymine dimer bypass by DNA polymerase eta occurs with biased fidelity.
14760703 2004 Proteomic identification of brain proteins that interact with dynein light chain LC8.
14734526 2004 DNA polymerase eta is involved in hypermutation occurring during immunoglobulin class switch recombination.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14630940 2003 A mechanism for the exclusion of low-fidelity human Y-family DNA polymerases from base excision repair.
14585988 2003 The mechanism of nucleotide incorporation by human DNA polymerase eta differs from that of the yeast enzyme.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14523013 2003 The efficiency and specificity of apurinic/apyrimidinic site bypass by human DNA polymerase eta and Sulfolobus solfataricus Dpo4.
12644471 2003 Role of DNA polymerase eta in the UV mutation spectrum in human cells.
12644469 2003 Amino acid substitutions at conserved tyrosine 52 alter fidelity and bypass efficiency of human DNA polymerase eta.
12606586 2003 Localization of DNA polymerases eta and iota to the replication machinery is tightly co-ordinated in human cells.
12584190 2003 Mammalian translesion DNA synthesis across an acrolein-derived deoxyguanosine adduct. Participation of DNA polymerase eta in error-prone synthesis in human cells.
12509472 2003 Nucleotide excision repair- and polymerase eta-mediated error-prone removal of mitomycin C interstrand cross-links.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12426396 2002 Localization of DNA polymerases eta and iota to the replication machinery is tightly co-ordinated in human cells.
12244178 2002 The role of polymerase eta in somatic hypermutation determined by analysis of mutations in a patient with xeroderma pigmentosum variant.
11773631 2002 Molecular analysis of mutations in DNA polymerase eta in xeroderma pigmentosum-variant patients.
11743006 2001 Mutations in human DNA polymerase eta motif II alter bypass of DNA lesions.
11585903 2001 Physical and functional interactions of human DNA polymerase eta with PCNA.
11554790 2001 Error rate and specificity of human and murine DNA polymerase eta.
11376341 2001 DNA polymerase eta is an A-T mutator in somatic hypermutation of immunoglobulin variable genes.
11121129 2000 Xeroderma pigmentosum variant heterozygotes show reduced levels of recovery of replicative DNA synthesis in the presence of caffeine after ultraviolet irradiation.
11032022 2000 Genomic structure, chromosomal localization and identification of mutations in the xeroderma pigmentosum variant (XPV) gene.
10871396 2000 Complementation of defective translesion synthesis and UV light sensitivity in xeroderma pigmentosum variant cells by human and mouse DNA polymerase eta.
10856253 2000 Mechanisms of accurate translesion synthesis by human DNA polymerase eta.
10398605 1999 hRAD30 mutations in the variant form of xeroderma pigmentosum.
10385124 1999 The XPV (xeroderma pigmentosum variant) gene encodes human DNA polymerase eta.