Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.18
PubTator Score 357.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.300 3.5e-02
oligodendroglioma -1.700 1.8e-02
group 4 medulloblastoma -2.200 4.3e-06
medulloblastoma, large-cell -1.100 3.0e-03
tuberculosis 1.200 8.2e-07
diabetes mellitus -1.100 1.3e-03
non primary Sjogren syndrome sicca 1.200 1.7e-02
lung carcinoma -1.500 5.2e-27
ovarian cancer 1.300 4.0e-04

 GO Process (1)

Gene RIF (1)

PMID Text
22190034 HIV-1 PR is identified to have a physical interaction with polymerase (DNA directed), epsilon 4 (POLE4) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALVKADPDVTLAGQEAIFILARA      1 - 70
AELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD                            71 - 117
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22190034 2011 Global landscape of HIV-human protein complexes.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18838386 2008 Human ATAC Is a GCN5/PCAF-containing acetylase complex with a novel NC2-like histone fold module that interacts with the TATA-binding protein.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10801849 2000 Identification and cloning of two histone fold motif-containing subunits of HeLa DNA polymerase epsilon.