Property Summary

NCBI Gene PubMed Count 16
PubMed Score 5.86
PubTator Score 35.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.100 3.4e-02
malignant mesothelioma 1.200 3.6e-06
Multiple myeloma 1.982 5.9e-04
ovarian cancer 2.000 5.3e-05
psoriasis 1.300 3.8e-04
Waldenstrons macroglobulinemia 1.055 3.0e-02

Gene RIF (1)

AA Sequence

MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVL      1 - 70
SAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQN     71 - 140
EEEEVDN                                                                   141 - 147
//

Text Mined References (21)

PMID Year Title