Property Summary

NCBI Gene PubMed Count 18
PubMed Score 16.80
PubTator Score 12.37

Knowledge Summary


No data available


  Differential Expression (20)

Gene RIF (4)

25924900 Inhibition of DNA polymerases a, delra and e by AFP promoter-driven artificial microRNAs may lead to effective growth arrest of AFP-positive HCC cells,as novel strategy for gene therapy
20065316 found that mutations occurred in POLE2 in 5 out of 16 cases of human colon cancer examined.
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18676977 The solution structure of the N-terminal domain of human DNA polymerase epsilon subunit B revealed a domain that consists of a left-handed superhelical bundle.

AA Sequence

NTECLCINPGSFPRSGFSFKVFYPSNKTVEDSKLQGF                                     491 - 527

Text Mined References (20)

PMID Year Title
25924900 2015 DNA Polymerases as targets for gene therapy of hepatocellular carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
20065316 Mutations/polymorphisms in the 55 kDa subunit of DNA polymerase epsilon in human colorectal cancer.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
18676977 2008 The solution structure of the amino-terminal domain of human DNA polymerase epsilon subunit B is homologous to C-domains of AAA+ proteins.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12045100 2002 DNA replication in eukaryotic cells.
11872158 2002 The second largest subunit of mouse DNA polymerase epsilon, DPE2, interacts with SAP18 and recruits the Sin3 co-repressor protein to DNA.
11433027 2001 E2F mediates induction of the Sp1-controlled promoter of the human DNA polymerase epsilon B-subunit gene POLE2.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
10801849 2000 Identification and cloning of two histone fold motif-containing subunits of HeLa DNA polymerase epsilon.
9443964 1998 The small subunits of human and mouse DNA polymerase epsilon are homologous to the second largest subunit of the yeast Saccharomyces cerevisiae DNA polymerase epsilon.
9405441 1997 Purification, cDNA cloning, and gene mapping of the small subunit of human DNA polymerase epsilon.
9111189 1997 Which DNA polymerases are used for DNA-repair in eukaryotes?
6693436 1984 DNA primase from KB cells. Characterization of a primase activity tightly associated with immunoaffinity-purified DNA polymerase-alpha.